| UniProt ID | MIS18_SCHPO | |
|---|---|---|
| UniProt AC | Q9P802 | |
| Protein Name | Kinetochore protein mis18 | |
| Gene Name | mis18 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 194 | |
| Subcellular Localization | Cytoplasm . Nucleus . Chromosome, centromere . Chromosome, centromere, kinetochore . | |
| Protein Description | Component of the CENP-A recruiting complex that ensures the integrity of mitotic spindles through maintenance of kinetochore factors mis6/CENP-I and cnp1/CENP-A. [PubMed: 15369671] | |
| Protein Sequence | MSQTETSHSGYIDFKKESQPSVFQCKKCFQIVGDSNAWVISHREYLSFTLSDAVENSVRVEDTFKRSDDGLCVYSELSCTRCNEVIGKVYNSTPIYLDDIRDMYTFSMDKLQAYQLGNKTVNPEGLTRYQVDLEMREDIIKLKSFCLSLYEKFELHDETLRSVKETISSLKKPKIEGKEGKKEKARTYSKRTRK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSQTETSHS ------CCCCCCCCC | 45.90 | 24763107 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MIS18_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MIS18_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MIS18_SCHPO !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CENPA_SCHPO | cnp1 | genetic | 15369671 | |
| HAT2_SCHPO | mis16 | physical | 15369671 | |
| PHD1_SCHPO | hos2 | genetic | 17352737 | |
| YBC2_SCHPO | mis19 | physical | 24789708 | |
| YG7G_SCHPO | mis20 | physical | 24789708 | |
| HAT2_SCHPO | mis16 | physical | 24789708 | |
| HAT2_SCHPO | mis16 | physical | 24774534 | |
| YBC2_SCHPO | mis19 | physical | 24774534 | |
| YG7G_SCHPO | mis20 | physical | 24774534 | |
| MIS18_SCHPO | mis18 | physical | 24774534 | |
| RENT1_SCHPO | upf1 | genetic | 24774534 | |
| NMD2_SCHPO | upf2 | genetic | 24774534 | |
| UPF3_SCHPO | upf3 | genetic | 24774534 | |
| YB33_SCHPO | ebs1 | genetic | 24774534 | |
| SNF22_SCHPO | snf22 | genetic | 24774534 | |
| SNF5_SCHPO | snf5 | genetic | 24774534 | |
| SOL1_SCHPO | sol1 | genetic | 24774534 | |
| MIS18_SCHPO | mis18 | physical | 26921242 | |
| MIS18_SCHPO | mis18 | physical | 26942680 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
