MET14_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MET14_DROME
• UniProt AC: Q9VLP7
• Protein Name: N6-adenosine-methyltransferase non-catalytic subunit {ECO:0000305}
• Gene Name: Mettl14 {ECO:0000303|PubMed:27919077, ECO:0000312|FlyBase:FBgn0032016}
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 397
• Subcellular Localization: Nucleus .
• Protein Description: Non-catalytic component of the WMM complex, a complex that mediates N6-methyladenosine (m6A) methylation of mRNAs, a modification that plays a role in the efficiency of mRNA splicing and is required for sex determination. [PubMed: 27919077]
• Protein Sequence: MSDVLKSSQERSRKRRLLLAQTLGLSSVDDLKKALGNAEDINSSRQLNSGGQREEEDGGASSSKKTPNEIIYRDSSTFLKGTQSSNPHNDYCQHFVDTGQRPQNFIRDVGLADRFEEYPKLRELIKLKDKLIQDTASAPMYLKADLKSLDVKTLGAKFDVILIEPPLEEYARAAPSVATVGGAPRVFWNWDDILNLDVGEIAAHRSFVFLWCGSSEGLDMGRNCLKKWGFRRCEDICWIRTNINKPGHSKQLEPKAVFQRTKEHCLMGIKGTVRRSTDGDFIHANVDIDLIISEEEEFGSFEKPIEIFHIIEHFCLGRRRLHLFGRDSSIRPGWLTVGPELTNSNFNSELYQTYFAEAPATGCTSRIELLRPKSPPPNSKVLRGRGRGFPRGRGRPR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
22	Phosphorylation	RRLLLAQTLGLSSVD HHHHHHHHHCCCCHH	19.72	21082442
26	Phosphorylation	LAQTLGLSSVDDLKK HHHHHCCCCHHHHHH	26.90	21082442
27	Phosphorylation	AQTLGLSSVDDLKKA HHHHCCCCHHHHHHH	34.31	21082442
374	Phosphorylation	IELLRPKSPPPNSKV EEEECCCCCCCCCCC	45.37	19429919
379	Phosphorylation	PKSPPPNSKVLRGRG CCCCCCCCCCCCCCC	29.89	19429919

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MET14_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MET14_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MET14_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
FL2D_DROME	fl(2)d	physical	27919077
MTA70_DROME	Ime4	physical	25242320
MTA70_DROME	Ime4	physical	27919077

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.