UniProt ID | MET14_DROME | |
---|---|---|
UniProt AC | Q9VLP7 | |
Protein Name | N6-adenosine-methyltransferase non-catalytic subunit {ECO:0000305} | |
Gene Name | Mettl14 {ECO:0000303|PubMed:27919077, ECO:0000312|FlyBase:FBgn0032016} | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 397 | |
Subcellular Localization | Nucleus . | |
Protein Description | Non-catalytic component of the WMM complex, a complex that mediates N6-methyladenosine (m6A) methylation of mRNAs, a modification that plays a role in the efficiency of mRNA splicing and is required for sex determination. [PubMed: 27919077] | |
Protein Sequence | MSDVLKSSQERSRKRRLLLAQTLGLSSVDDLKKALGNAEDINSSRQLNSGGQREEEDGGASSSKKTPNEIIYRDSSTFLKGTQSSNPHNDYCQHFVDTGQRPQNFIRDVGLADRFEEYPKLRELIKLKDKLIQDTASAPMYLKADLKSLDVKTLGAKFDVILIEPPLEEYARAAPSVATVGGAPRVFWNWDDILNLDVGEIAAHRSFVFLWCGSSEGLDMGRNCLKKWGFRRCEDICWIRTNINKPGHSKQLEPKAVFQRTKEHCLMGIKGTVRRSTDGDFIHANVDIDLIISEEEEFGSFEKPIEIFHIIEHFCLGRRRLHLFGRDSSIRPGWLTVGPELTNSNFNSELYQTYFAEAPATGCTSRIELLRPKSPPPNSKVLRGRGRGFPRGRGRPR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
22 | Phosphorylation | RRLLLAQTLGLSSVD HHHHHHHHHCCCCHH | 19.72 | 21082442 | |
26 | Phosphorylation | LAQTLGLSSVDDLKK HHHHHCCCCHHHHHH | 26.90 | 21082442 | |
27 | Phosphorylation | AQTLGLSSVDDLKKA HHHHCCCCHHHHHHH | 34.31 | 21082442 | |
374 | Phosphorylation | IELLRPKSPPPNSKV EEEECCCCCCCCCCC | 45.37 | 19429919 | |
379 | Phosphorylation | PKSPPPNSKVLRGRG CCCCCCCCCCCCCCC | 29.89 | 19429919 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MET14_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MET14_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MET14_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
FL2D_DROME | fl(2)d | physical | 27919077 | |
MTA70_DROME | Ime4 | physical | 25242320 | |
MTA70_DROME | Ime4 | physical | 27919077 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...