UniProt ID | MEF2B_HUMAN | |
---|---|---|
UniProt AC | Q02080 | |
Protein Name | Myocyte-specific enhancer factor 2B | |
Gene Name | MEF2B | |
Organism | Homo sapiens (Human). | |
Sequence Length | 365 | |
Subcellular Localization | Nucleus. | |
Protein Description | Transcriptional activator which binds specifically to the MEF2 element, 5'-YTA[AT](4)TAR-3', found in numerous muscle-specific genes. Activates transcription via this element. May be involved in muscle-specific and/or growth factor-related transcription.. | |
Protein Sequence | MGRKKIQISRILDQRNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSANRLFQYASTDMDRVLLKYTEYSEPHESRTNTDILETLKRRGIGLDGPELEPDEGPEEPGEKFRRLAGEGGDPALPRPRLYPAAPAMPSPDVVYGALPPPGCDPSGLGEALPAQSRPSPFRPAAPKAGPPGLVHPLFSPSHLTSKTPPPLYLPTEGRRSDLPGGLAGPRGGLNTSRSLYSGLQNPCSTATPGPPLGSFPFLPGGPPVGAEAWARRVPQPAAPPRRPPQSASSLSASLRPPGAPATFLRPSPIPCSSPGPWQSLCGLGPPCAGCPWPTAGPGRRSPGGTSPERSPGTARARGDPTSLQASSEKTQQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
23 | Ubiquitination | NRQVTFTKRKFGLMK CCCCHHHHHHHCCCH | 49.77 | 32015554 | |
57 | Phosphorylation | SANRLFQYASTDMDR CCCHHHHHCCCCHHH | 8.66 | 24043423 | |
70 | Phosphorylation | DRVLLKYTEYSEPHE HHHHHHHHCCCCCCC | 27.19 | 30108239 | |
72 | Phosphorylation | VLLKYTEYSEPHESR HHHHHHCCCCCCCCC | 15.55 | 30108239 | |
73 | Phosphorylation | LLKYTEYSEPHESRT HHHHHCCCCCCCCCC | 38.12 | 30108239 | |
78 | Phosphorylation | EYSEPHESRTNTDIL CCCCCCCCCCCHHHH | 41.17 | 30108239 | |
89 | Ubiquitination | TDILETLKRRGIGLD HHHHHHHHHCCCCCC | 47.68 | 21906983 | |
112 | Ubiquitination | GPEEPGEKFRRLAGE CCCCCCHHHHHHHCC | 50.51 | 21906983 | |
139 | Phosphorylation | PAAPAMPSPDVVYGA CCCCCCCCCCCEEEC | 22.20 | 26714015 | |
188 | Phosphorylation | GLVHPLFSPSHLTSK CCCCCCCCHHHHCCC | 32.93 | 30108239 | |
190 | Phosphorylation | VHPLFSPSHLTSKTP CCCCCCHHHHCCCCC | 29.90 | 30108239 | |
193 | Phosphorylation | LFSPSHLTSKTPPPL CCCHHHHCCCCCCCE | 23.82 | 30108239 | |
194 | Phosphorylation | FSPSHLTSKTPPPLY CCHHHHCCCCCCCEE | 40.67 | 30108239 | |
196 | Phosphorylation | PSHLTSKTPPPLYLP HHHHCCCCCCCEECC | 40.57 | 30108239 | |
201 | Phosphorylation | SKTPPPLYLPTEGRR CCCCCCEECCCCCCC | 19.19 | 30108239 | |
204 | Phosphorylation | PPPLYLPTEGRRSDL CCCEECCCCCCCCCC | 48.77 | 25332170 | |
284 | Phosphorylation | PQSASSLSASLRPPG CCCHHHHCHHCCCCC | 20.12 | 24905233 | |
286 | Phosphorylation | SASSLSASLRPPGAP CHHHHCHHCCCCCCC | 22.87 | 24905233 | |
291 (in isoform 2) | Phosphorylation | - | 47.04 | 26714015 | |
294 | Phosphorylation | LRPPGAPATFLRPSP CCCCCCCCCEECCCC | 15.51 | - | |
294 (in isoform 2) | Phosphorylation | - | 15.51 | 26714015 | |
298 (in isoform 2) | Phosphorylation | - | 26.01 | 30108239 | |
306 (in isoform 2) | Phosphorylation | - | 40.36 | 25954137 | |
310 | Phosphorylation | PCSSPGPWQSLCGLG CCCCCCCHHHHCCCC | 13.30 | 27251275 | |
310 (in isoform 2) | Phosphorylation | - | 13.30 | 30108239 | |
313 | Phosphorylation | SPGPWQSLCGLGPPC CCCCHHHHCCCCCCC | 1.28 | 27251275 | |
313 (in isoform 2) | Phosphorylation | - | 1.28 | 30108239 | |
317 | Phosphorylation | WQSLCGLGPPCAGCP HHHHCCCCCCCCCCC | 14.91 | - | |
317 (in isoform 2) | Phosphorylation | - | 14.91 | 24667141 | |
319 | Sumoylation | SLCGLGPPCAGCPWP HHCCCCCCCCCCCCC | 20.84 | - | |
320 (in isoform 2) | Phosphorylation | - | 5.98 | 26657352 | |
324 | Phosphorylation | GPPCAGCPWPTAGPG CCCCCCCCCCCCCCC | 38.88 | 24719451 | |
324 (in isoform 2) | Phosphorylation | - | 38.88 | 26657352 | |
334 | Phosphorylation | TAGPGRRSPGGTSPE CCCCCCCCCCCCCCC | 26.91 | 25954137 | |
339 | Phosphorylation | RRSPGGTSPERSPGT CCCCCCCCCCCCCCC | 28.21 | 25954137 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MEF2B_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MEF2B_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MEF2B_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TEX11_HUMAN | TEX11 | physical | 16189514 | |
CABIN_HUMAN | CABIN1 | physical | 12700764 | |
CABIN_HUMAN | CABIN1 | physical | 10531067 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...