MB3L2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MB3L2_HUMAN
• UniProt AC: Q8NHZ7
• Protein Name: Methyl-CpG-binding domain protein 3-like 2
• Gene Name: MBD3L2
• Organism: Homo sapiens (Human).
• Sequence Length: 208
• Protein Sequence: MGEPAFTSFPSLPVLGKLKRNMMPWALQKKREIHMAKAHRRRAARSALPMRLTSCIFRRPVTRIRSHPDNQVRRRKGDEHLEKPQQLCAYRRLQALQPCSSQGEGSSPLHLESVLSILAPGTAGESLDRAGAERVRSPLEPTPGRFPAVAGGPTPGMGCQLPPPLSGQLVTPADIRRQARRVKKARERLAKALQADRLARRAEMLTGG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of MB3L2_HUMAN !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MB3L2_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MB3L2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MB3L2_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MBD3_HUMAN	MBD3	physical	15701600
MBD2_HUMAN	MBD2	physical	15701600
CHD4_HUMAN	CHD4	physical	15701600
MTA2_HUMAN	MTA2	physical	15701600
MTA1_HUMAN	MTA1	physical	15701600
DPOD3_HUMAN	POLD3	physical	15701600
HDAC1_HUMAN	HDAC1	physical	15701600
HDAC2_HUMAN	HDAC2	physical	15701600
RBBP4_HUMAN	RBBP4	physical	15701600
RBBP7_HUMAN	RBBP7	physical	15701600

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.