UniProt ID | MANBL_HUMAN | |
---|---|---|
UniProt AC | Q9NQG1 | |
Protein Name | Protein MANBAL | |
Gene Name | MANBAL | |
Organism | Homo sapiens (Human). | |
Sequence Length | 85 | |
Subcellular Localization |
Membrane Single-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MASDLDFSPPEVPEPTFLENLLRYGLFLGAIFQLICVLAIIVPIPKSHEAEAEPSEPRSAEVTRKPKAAVPSVNKRPKKETKKKR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
59 | Phosphorylation | AEPSEPRSAEVTRKP CCCCCCCCCHHCCCC | 39.22 | 25159151 | |
63 | Phosphorylation | EPRSAEVTRKPKAAV CCCCCHHCCCCCCCC | 25.20 | 30624053 | |
72 | Phosphorylation | KPKAAVPSVNKRPKK CCCCCCCCCCCCCCH | 31.55 | 28355574 | |
72 | O-linked_Glycosylation | KPKAAVPSVNKRPKK CCCCCCCCCCCCCCH | 31.55 | OGP |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MANBL_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MANBL_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MANBL_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GOPC_HUMAN | GOPC | physical | 28514442 | |
S10A6_HUMAN | S100A6 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...