LYL1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: LYL1_HUMAN
• UniProt AC: P12980
• Protein Name: Protein lyl-1
• Gene Name: LYL1
• Organism: Homo sapiens (Human).
• Sequence Length: 280
• Subcellular Localization: Nucleus .
• Protein Sequence: MCPPQAQAEVGPTMTEKAEMVCAPSPAPAPPPKPASPGPPQVEEVGHRGGSSPPRLPPGVPVISLGHSRPPGVAMPTTELGTLRPPLLQLSTLGTAPPTLALHYHPHPFLNSVYIGPAGPFSIFPSSRLKRRPSHCELDLAEGHQPQKVARRVFTNSRERWRQQNVNGAFAELRKLLPTHPPDRKLSKNEVLRLAMKYIGFLVRLLRDQAAALAAGPTPPGPRKRPVHRVPDDGARRGSGRRAEAAARSQPAPPADPDGSPGGAARPIKMEQTALSPEVR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
25	Phosphorylation	AEMVCAPSPAPAPPP EEEEECCCCCCCCCC	18.37	23401153
36	Phosphorylation	APPPKPASPGPPQVE CCCCCCCCCCCCCCE	38.63	23401153
52	Phosphorylation	VGHRGGSSPPRLPPG CCCCCCCCCCCCCCC	42.05	24247654
134	Phosphorylation	SRLKRRPSHCELDLA HHCCCCCCCCCCCCC	38.67	23401153
188	Acetylation	PPDRKLSKNEVLRLA CCCCCCCHHHHHHHH	68.51	25953088
260	Phosphorylation	PPADPDGSPGGAARP CCCCCCCCCCCCCCC	27.96	23401153
273	Phosphorylation	RPIKMEQTALSPEVR CCCCCCCCCCCCCCC	19.09	23403867
276	Phosphorylation	KMEQTALSPEVR--- CCCCCCCCCCCC---	19.29	23401153

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
36	S	Phosphorylation	Kinase	MAPK1	P28482	GPS
36	S	Phosphorylation	Kinase	MAPK3	P27361	GPS
36	S	Phosphorylation	Kinase	MAPK-FAMILY	-	GPS

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of LYL1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of LYL1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
NFKB1_HUMAN	NFKB1	physical	10023675
IKBA_HUMAN	NFKBIA	physical	10023675
RBTN1_HUMAN	LMO1	physical	7957052
RBTN2_HUMAN	LMO2	physical	7957052
TFE2_HUMAN	TCF3	physical	8628307

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.