LTC4S_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: LTC4S_HUMAN
• UniProt AC: Q16873
• Protein Name: Leukotriene C4 synthase
• Gene Name: LTC4S
• Organism: Homo sapiens (Human).
• Sequence Length: 150
• Subcellular Localization: Nucleus outer membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.
• Protein Description: Catalyzes the conjugation of leukotriene A4 with reduced glutathione to form leukotriene C4..
• Protein Sequence: MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTLLPWA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
36	Phosphorylation	ARRAFRVSPPLTTGP HHHHHCCCCCCCCCC	19.28	27365393
40	Phosphorylation	FRVSPPLTTGPPEFE HCCCCCCCCCCCHHH	35.17	-
109	Phosphorylation	QLRLAPLYASARALW HHHHHHHHHHHHHHH	9.46	22817900

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
36	S	Phosphorylation	Kinase	P70S6K	P23443	PSP

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
36	S	Phosphorylation	Phosphorylation at Ser-36 by RPS6KB1 inhibits the leukotriene-C4 synthase activity.	27365393

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of LTC4S_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
LOX5_HUMAN	ALOX5	physical	19233132
AL5AP_HUMAN	ALOX5AP	physical	19233132
LTC4S_HUMAN	LTC4S	physical	19233132
LTC4S_HUMAN	LTC4S	physical	22139193
LTC4S_HUMAN	LTC4S	physical	17632546
LTC4S_HUMAN	LTC4S	physical	17632548

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• DB00143: Glutathione