dbPTM

AL5AP_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	AL5AP_HUMAN
UniProt AC	P20292
Protein Name	Arachidonate 5-lipoxygenase-activating protein
Gene Name	ALOX5AP
Organism	Homo sapiens (Human).
Sequence Length	161
Subcellular Localization	Nucleus membrane Multi-pass membrane protein. Endoplasmic reticulum membrane Multi-pass membrane protein.
Protein Description	Required for leukotriene biosynthesis by ALOX5 (5-lipoxygenase). Anchors ALOX5 to the membrane. Binds arachidonic acid, and could play an essential role in the transfer of arachidonic acid to ALOX5. Binds to MK-886, a compound that blocks the biosynthesis of leukotrienes..
Protein Sequence	MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
41	Phosphorylation	SRTQNGRSFQRTGTL CCCCCCCCCCHHCEE	27.42	29978859
45	Phosphorylation	NGRSFQRTGTLAFER CCCCCCHHCEECEEE	24.60	27486199
47	Phosphorylation	RSFQRTGTLAFERVY CCCCHHCEECEEEEE	17.82	27486199

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of AL5AP_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of AL5AP_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of AL5AP_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
LOX5_HUMAN	ALOX5	physical	19233132
AL5AP_HUMAN	ALOX5AP	physical	17600184
CLIC1_HUMAN	CLIC1	physical	21988832
F10C1_HUMAN	FRA10AC1	physical	28514442

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of AL5AP_HUMAN

Related Literatures of Post-Translational Modification