LRC29_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: LRC29_HUMAN
• UniProt AC: Q8WV35
• Protein Name: Leucine-rich repeat-containing protein 29
• Gene Name: LRRC29
• Organism: Homo sapiens (Human).
• Sequence Length: 223
• Protein Description: Probably recognizes and binds to some phosphorylated proteins and promotes their ubiquitination and degradation..
• Protein Sequence: MYSSGWPAGAAEPRHGRGRELAQALGCMHGAPSQLASLSLAHCSSLKSRPELEHQASGTKDACPEPQGPSLLTLRALQELDLTACSKLTDASLAKVLQFLQLRQLSLSLLPELTDNGLVAVARGCPSLEHLALSHCSRLSDKGWAQAASSWPRLQHLNLSSCSQLIEQTLDAIGQACRQLRVLDVATCPGINMAAVRRFQAQLPQVSCVQSRFVGGADLTLTL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
4	Phosphorylation	----MYSSGWPAGAA ----CCCCCCCCCCC	27.65	22617229
140	Phosphorylation	LSHCSRLSDKGWAQA HHHHHHHCCHHHHHH	35.85	26329039
150	Phosphorylation	GWAQAASSWPRLQHL HHHHHHHHCCCCHHC	36.05	24719451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of LRC29_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of LRC29_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of LRC29_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ATL4_HUMAN	ADAMTSL4	physical	25416956
KLH40_HUMAN	KLHL40	physical	25416956
HOOK1_HUMAN	HOOK1	physical	26186194
STIL_HUMAN	STIL	physical	26186194
AMRA1_HUMAN	AMBRA1	physical	26186194
HOOK1_HUMAN	HOOK1	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.