LOLAL_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: LOLAL_DROME
• UniProt AC: Q7KRI2
• Protein Name: Longitudinals lacking protein-like
• Gene Name: lolal {ECO:0000312|EMBL:AAM68179.1}
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 127
• Subcellular Localization: Nucleus .
• Protein Description: Required, together with Trl, for maintaining the repressed state of target genes including homeotic genes Scr and Ubx. May also be involved in the activation of homeotic genes. Binds to a DNA Polycomb response element (PRE) at the bithorax complex. Also binds to polytene chromosomes at several hundred sites, many of which are shared with Trl and ph-p. Required during embryonic development..
• Protein Sequence: MMSSDQQFFLKWNDFQTNMVTSFRHLRDEKSFTDVTLACEGQTCKAHKMVLSACSPYFKALLEENPSKHPIIILKDVSYIHLQAILEFMYAGEVNVSQEQLPAFLKTADRLKVKGLAETPSSIKREG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of LOLAL_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of LOLAL_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of LOLAL_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of LOLAL_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GAGA_DROME	Trl	physical	14605208
HLES_DROME	H	genetic	10835395

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.