LN28A_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: LN28A_MOUSE
• UniProt AC: Q8K3Y3
• Protein Name: Protein lin-28 homolog A
• Gene Name: Lin28a
• Organism: Mus musculus (Mouse).
• Sequence Length: 209
• Subcellular Localization: Cytoplasm . Rough endoplasmic reticulum . Cytoplasm, P-body . Cytoplasm, Stress granule . Nucleus, nucleolus . Predominantly cytoplasmic (PubMed:12798299). In the cytoplasm, localizes to peri-endoplasmic reticulum regions and detected in the microsom
• Protein Description: RNA-binding protein that inhibits processing of pre-let-7 miRNAs and regulates translation of mRNAs that control developmental timing, pluripotency and metabolism. [PubMed: 17473174]
• Protein Sequence: MGSVSNQQFAGGCAKAAEKAPEEAPPDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGKNMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSINHMVASCPLKAQQGPSSQGKPAYFREEEEEIHSPALLPEAQN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MGSVSNQQF ------CCCCCHHHC	36.43	-
3	Phosphorylation	-----MGSVSNQQFA -----CCCCCHHHCC	22.52	28066266
5	Phosphorylation	---MGSVSNQQFAGG ---CCCCCHHHCCCH	30.53	28066266
120	Phosphorylation	GGVFCIGSERRPKGK CCEEEECCCCCCCCC	14.18	-
183	Phosphorylation	LKAQQGPSSQGKPAY CCCCCCCCCCCCCCC	41.96	28066266
184	Phosphorylation	KAQQGPSSQGKPAYF CCCCCCCCCCCCCCC	46.19	28066266
200	Phosphorylation	EEEEEIHSPALLPEA CCHHHCCCCCCCCCC	19.96	21149613

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
200	S	Phosphorylation	Kinase	ERK2	P28482	PSP
200	S	Phosphorylation	Kinase	ERK1	P27361	PSP

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of LN28A_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of LN28A_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TAF12_HUMAN	TAF12	physical	26496610
BRWD1_HUMAN	BRWD1	physical	26496610
KATL1_HUMAN	KATNAL1	physical	26496610

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.