UniProt ID | LN28A_MOUSE | |
---|---|---|
UniProt AC | Q8K3Y3 | |
Protein Name | Protein lin-28 homolog A | |
Gene Name | Lin28a | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 209 | |
Subcellular Localization | Cytoplasm . Rough endoplasmic reticulum . Cytoplasm, P-body . Cytoplasm, Stress granule . Nucleus, nucleolus . Predominantly cytoplasmic (PubMed:12798299). In the cytoplasm, localizes to peri-endoplasmic reticulum regions and detected in the microsom | |
Protein Description | RNA-binding protein that inhibits processing of pre-let-7 miRNAs and regulates translation of mRNAs that control developmental timing, pluripotency and metabolism. [PubMed: 17473174] | |
Protein Sequence | MGSVSNQQFAGGCAKAAEKAPEEAPPDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGKNMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSINHMVASCPLKAQQGPSSQGKPAYFREEEEEIHSPALLPEAQN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MGSVSNQQF ------CCCCCHHHC | 36.43 | - | |
3 | Phosphorylation | -----MGSVSNQQFA -----CCCCCHHHCC | 22.52 | 28066266 | |
5 | Phosphorylation | ---MGSVSNQQFAGG ---CCCCCHHHCCCH | 30.53 | 28066266 | |
120 | Phosphorylation | GGVFCIGSERRPKGK CCEEEECCCCCCCCC | 14.18 | - | |
183 | Phosphorylation | LKAQQGPSSQGKPAY CCCCCCCCCCCCCCC | 41.96 | 28066266 | |
184 | Phosphorylation | KAQQGPSSQGKPAYF CCCCCCCCCCCCCCC | 46.19 | 28066266 | |
200 | Phosphorylation | EEEEEIHSPALLPEA CCHHHCCCCCCCCCC | 19.96 | 21149613 |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LN28A_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LN28A_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TAF12_HUMAN | TAF12 | physical | 26496610 | |
BRWD1_HUMAN | BRWD1 | physical | 26496610 | |
KATL1_HUMAN | KATNAL1 | physical | 26496610 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...