LMO4_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: LMO4_MOUSE
• UniProt AC: P61969
• Protein Name: LIM domain transcription factor LMO4
• Gene Name: Lmo4
• Organism: Mus musculus (Mouse).
• Sequence Length: 165
• Protein Description: Probable transcriptional factor..
• Protein Sequence: MVNPGSSSQPPPVTAGSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGTSCYTKSGMILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSLFCEHDRPTALINGHLNSLQSNPLLPDQKVC

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
6	Phosphorylation	--MVNPGSSSQPPPV --CCCCCCCCCCCCC	28.24	-
7	Phosphorylation	-MVNPGSSSQPPPVT -CCCCCCCCCCCCCC	38.62	-
37	Phosphorylation	IADRFLLYAMDSYWH HHHHHHHHHHHHHHH	11.30	28576409

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of LMO4_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of LMO4_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of LMO4_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
LMO4_MOUSE	Lmo4	physical	20211142
SSBP2_MOUSE	Ssbp2	physical	20211142

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.