| UniProt ID | LMF2_HUMAN | |
|---|---|---|
| UniProt AC | Q9BU23 | |
| Protein Name | Lipase maturation factor 2 | |
| Gene Name | LMF2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 707 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein. |
|
| Protein Description | Involved in the maturation of specific proteins in the endoplasmic reticulum. May be required for maturation and transport of active lipoprotein lipase (LPL) through the secretory pathway (By similarity).. | |
| Protein Sequence | MAGSRLPRQLFLQGVAAVFMFAFASLYTQIPGLYGPEGILPARRTLRPQGKGRWQQLWETPTLLWEAPRLGLDTAQGLELLSLLGALVALGALLLSPLRHPVIYLLLWAAYLSACQVGQVFLYFQWDSLLLETGFLAVLVAPLRPASHRKEAPQGRQAGALPHEDLPFWLVRWLLFRLMFASGVVKLTSRCPAWWGLTALTYHYETQCLPTPAAWFAHHLPVWLHKLSVVATFLIEIAVPPLFFAPIRRLRLAAFYSQVLLQVLIIITGNYNFFNLMTLVLTTALLDDQHLAAEPGHGSRKKTATSWPKALLATLSLLLELAVYGLLAYGTVHYFGLEVDWQQRTIHSRTTFTFHQFSQWLKTLTLPTVWLGVASLVWELLSALWRWTQVRGWLRKLSAVVQLSLVGTATVALFLISLVPYSYVEPGTHGRLWTGAHRLFGAVEHLQLANSYGLFRRMTGLGGRPEVVLEGSYDGHHWTEIEFMYKPGNLSRPPPVVVPHQPRLDWQMWFAALGPHTHSPWFTSLVLRLLQGKEPVIRLVQSQVARYPFHKQPPTYVRAQRYKYWFSQPGEQGQWWRRQWVEEFFPSVSLGDPTLETLLRQFGLQEKSPPRTRSANSTLAQALHWTRSQLSPLEAPALLWGLLMAVGAVRFVQALLAPCSLRSSPLAPVSGEKRRPASQKDSGAASEQATAAPNPCSSSSRTTRRKK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 4 | Phosphorylation | ----MAGSRLPRQLF ----CCCCCCCHHHH | 22.55 | 26074081 | |
| 25 | Phosphorylation | VFMFAFASLYTQIPG HHHHHHHHHHHCCCC | 18.56 | 24043423 | |
| 26 (in isoform 2) | Ubiquitination | - | 4.87 | 21890473 | |
| 27 | Phosphorylation | MFAFASLYTQIPGLY HHHHHHHHHCCCCCC | 8.29 | 24043423 | |
| 28 | Phosphorylation | FAFASLYTQIPGLYG HHHHHHHHCCCCCCC | 25.89 | 24043423 | |
| 34 | Phosphorylation | YTQIPGLYGPEGILP HHCCCCCCCCCCCCC | 36.23 | 24043423 | |
| 51 | Ubiquitination | RTLRPQGKGRWQQLW CCCCCCCCCHHHHHH | 39.80 | 21906983 | |
| 51 (in isoform 3) | Ubiquitination | - | 39.80 | 21890473 | |
| 51 (in isoform 1) | Ubiquitination | - | 39.80 | 21890473 | |
| 60 | Phosphorylation | RWQQLWETPTLLWEA HHHHHHCCCCCHHHC | 15.25 | 22468782 | |
| 62 | Phosphorylation | QQLWETPTLLWEAPR HHHHCCCCCHHHCCC | 41.73 | 22468782 | |
| 96 | Phosphorylation | ALGALLLSPLRHPVI HHHHHHHHCCCCHHH | 23.12 | 24719451 | |
| 302 | Ubiquitination | PGHGSRKKTATSWPK CCCCCCCCCCCCHHH | 42.13 | - | |
| 420 (in isoform 3) | Ubiquitination | - | 20.04 | 21890473 | |
| 438 (in isoform 3) | Ubiquitination | - | 31.04 | 21890473 | |
| 459 | Phosphorylation | YGLFRRMTGLGGRPE HCHHHHHHCCCCCCE | 27.69 | 24719451 | |
| 478 | Ubiquitination | GSYDGHHWTEIEFMY CCCCCCCEEEEEEEE | 7.05 | 21890473 | |
| 489 | N-linked_Glycosylation | EFMYKPGNLSRPPPV EEEECCCCCCCCCCE | 43.29 | UniProtKB CARBOHYD | |
| 495 | Ubiquitination | GNLSRPPPVVVPHQP CCCCCCCCEECCCCC | 33.93 | 21890473 | |
| 496 | Ubiquitination | NLSRPPPVVVPHQPR CCCCCCCEECCCCCC | 9.27 | 21890473 | |
| 508 (in isoform 2) | Ubiquitination | - | 2.50 | 21890473 | |
| 508 | Ubiquitination | QPRLDWQMWFAALGP CCCCCHHHHHHHHCC | 2.50 | 21890473 | |
| 513 | Ubiquitination | WQMWFAALGPHTHSP HHHHHHHHCCCCCCH | 11.13 | 21890473 | |
| 526 (in isoform 2) | Ubiquitination | - | 2.68 | 21890473 | |
| 526 | Ubiquitination | SPWFTSLVLRLLQGK CHHHHHHHHHHHCCC | 2.68 | 21890473 | |
| 533 | 2-Hydroxyisobutyrylation | VLRLLQGKEPVIRLV HHHHHCCCCCCHHHH | 45.98 | - | |
| 533 (in isoform 1) | Ubiquitination | - | 45.98 | 21890473 | |
| 533 | Ubiquitination | VLRLLQGKEPVIRLV HHHHHCCCCCCHHHH | 45.98 | 21890473 | |
| 551 | Ubiquitination | VARYPFHKQPPTYVR HHCCCCCCCCCCEEE | 65.95 | 21890473 | |
| 551 (in isoform 1) | Ubiquitination | - | 65.95 | 21890473 | |
| 552 | Ubiquitination | ARYPFHKQPPTYVRA HCCCCCCCCCCEEEE | 40.41 | 24816145 | |
| 563 | Ubiquitination | YVRAQRYKYWFSQPG EEEEEEEEEECCCCC | 37.89 | - | |
| 569 | Ubiquitination | YKYWFSQPGEQGQWW EEEECCCCCCCCCHH | 47.27 | 24816145 | |
| 582 | Ubiquitination | WWRRQWVEEFFPSVS HHHHHHHHHHCCCCC | 46.24 | 24816145 | |
| 607 | Ubiquitination | RQFGLQEKSPPRTRS HHCCCCCCCCCCCCC | 56.13 | 33845483 | |
| 608 | Phosphorylation | QFGLQEKSPPRTRSA HCCCCCCCCCCCCCC | 39.11 | - | |
| 612 | Phosphorylation | QEKSPPRTRSANSTL CCCCCCCCCCCHHHH | 34.45 | - | |
| 616 | N-linked_Glycosylation | PPRTRSANSTLAQAL CCCCCCCHHHHHHHH | 36.45 | UniProtKB CARBOHYD | |
| 617 | Phosphorylation | PRTRSANSTLAQALH CCCCCCHHHHHHHHH | 25.23 | - | |
| 618 | Ubiquitination | RTRSANSTLAQALHW CCCCCHHHHHHHHHH | 26.39 | 24816145 | |
| 635 | Ubiquitination | SQLSPLEAPALLWGL HCCCCCHHHHHHHHH | 11.44 | 24816145 | |
| 648 | Ubiquitination | GLLMAVGAVRFVQAL HHHHHHHHHHHHHHH | 5.23 | 24816145 | |
| 659 | S-palmitoylation | VQALLAPCSLRSSPL HHHHHCCCCCCCCCC | 5.07 | 29575903 | |
| 663 | Phosphorylation | LAPCSLRSSPLAPVS HCCCCCCCCCCCCCC | 41.42 | 27251275 | |
| 664 | Phosphorylation | APCSLRSSPLAPVSG CCCCCCCCCCCCCCC | 19.94 | 29396449 | |
| 670 | Phosphorylation | SSPLAPVSGEKRRPA CCCCCCCCCCCCCCC | 39.93 | 26055452 | |
| 673 | Ubiquitination | LAPVSGEKRRPASQK CCCCCCCCCCCCCCC | 58.18 | 24816145 | |
| 673 | 2-Hydroxyisobutyrylation | LAPVSGEKRRPASQK CCCCCCCCCCCCCCC | 58.18 | - | |
| 673 | Malonylation | LAPVSGEKRRPASQK CCCCCCCCCCCCCCC | 58.18 | 26320211 | |
| 678 | Phosphorylation | GEKRRPASQKDSGAA CCCCCCCCCCCCCHH | 40.21 | 23401153 | |
| 680 | Acetylation | KRRPASQKDSGAASE CCCCCCCCCCCHHHH | 51.90 | 7925397 | |
| 682 | Phosphorylation | RPASQKDSGAASEQA CCCCCCCCCHHHHHH | 37.05 | 19413330 | |
| 686 | Phosphorylation | QKDSGAASEQATAAP CCCCCHHHHHHCCCC | 29.70 | 19413330 | |
| 690 | Phosphorylation | GAASEQATAAPNPCS CHHHHHHCCCCCCCC | 24.05 | 28985074 | |
| 697 | Phosphorylation | TAAPNPCSSSSRTTR CCCCCCCCCCCCCCC | 34.22 | 25159151 | |
| 698 | Phosphorylation | AAPNPCSSSSRTTRR CCCCCCCCCCCCCCC | 38.76 | 25159151 | |
| 699 | Phosphorylation | APNPCSSSSRTTRRK CCCCCCCCCCCCCCC | 13.93 | 28450419 | |
| 700 | Phosphorylation | PNPCSSSSRTTRRKK CCCCCCCCCCCCCCC | 35.28 | 21712546 | |
| 702 | Phosphorylation | PCSSSSRTTRRKK-- CCCCCCCCCCCCC-- | 26.97 | 30177828 | |
| 703 | Phosphorylation | CSSSSRTTRRKK--- CCCCCCCCCCCC--- | 27.63 | 30177828 | |
| 706 | Acetylation | SSRTTRRKK------ CCCCCCCCC------ | 60.59 | 7925407 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LMF2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LMF2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LMF2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| K1C40_HUMAN | KRT40 | physical | 25416956 | |
| KR103_HUMAN | KRTAP10-3 | physical | 25416956 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-682 AND SER-686, ANDMASS SPECTROMETRY. | |