UniProt ID | LFG4_HUMAN | |
---|---|---|
UniProt AC | Q9HC24 | |
Protein Name | Protein lifeguard 4 | |
Gene Name | TMBIM4 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 238 | |
Subcellular Localization |
Golgi apparatus membrane Multi-pass membrane protein . |
|
Protein Description | Anti-apoptotic protein which can inhibit apoptosis induced by intrinsic and extrinsic apoptotic stimuli. Can modulate both capacitative Ca2+ entry and inositol 1,4,5-trisphosphate (IP3)-mediated Ca2+ release.. | |
Protein Sequence | MADPDPRYPRSSIEDDFNYGSSVASATVHIRMAFLRKVYSILSLQVLLTTVTSTVFLYFESVRTFVHESPALILLFALGSLGLIFALILNRHKYPLNLYLLFGFTLLEALTVAVVVTFYDVYIILQAFILTTTVFFGLTVYTLQSKKDFSKFGAGLFALLWILCLSGFLKFFFYSEIMELVLAAAGALLFCGFIIYDTHSLMHKLSPEEYVLAAISLYLDIINLFLHLLRFLEAVNKK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LFG4_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LFG4_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LFG4_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
S27A4_HUMAN | SLC27A4 | physical | 17353931 | |
RPN2_HUMAN | RPN2 | physical | 17353931 | |
CCD47_HUMAN | CCDC47 | physical | 17353931 | |
OST48_HUMAN | DDOST | physical | 17353931 | |
PPIB_HUMAN | PPIB | physical | 17353931 | |
MTX1_HUMAN | MTX1 | physical | 17353931 | |
KPRA_HUMAN | PRPSAP1 | physical | 17353931 | |
DFFA_HUMAN | DFFA | physical | 17353931 | |
COX41_HUMAN | COX4I1 | physical | 17353931 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...