| UniProt ID | KNAT4_ARATH | |
|---|---|---|
| UniProt AC | P48001 | |
| Protein Name | Homeobox protein knotted-1-like 4 | |
| Gene Name | KNAT4 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 393 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | ||
| Protein Sequence | MAFHNNHFNHFTDQQQHQPPPPPQQQQQQHFQESAPPNWLLRSDNNFLNLHTAASAAATSSDSPSSAAANQWLSRSSSFLQRGNTANNNNNETSGDVIEDVPGGEESMIGEKKEAERWQNARHKAEILSHPLYEQLLSAHVACLRIATPVDQLPRIDAQLAQSQNVVAKYSTLEAAQGLLAGDDKELDHFMTHYVLLLCSFKEQLQQHVRVHAMEAVMACWEIEQSLQSFTGVSPGEGTGATMSEDEDEQVESDAHLFDGSLDGLGFGPLVPTESERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKSWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVSKNKRRSNAGENSGRDR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 76 | Phosphorylation | ANQWLSRSSSFLQRG HHHHHHHCHHHHHHC | 27.27 | 28011693 | |
| 77 | Phosphorylation | NQWLSRSSSFLQRGN HHHHHHCHHHHHHCC | 24.81 | 30407730 | |
| 78 | Phosphorylation | QWLSRSSSFLQRGNT HHHHHCHHHHHHCCC | 31.09 | 30291188 | |
| 389 | Phosphorylation | RSNAGENSGRDR--- CCCCCCCCCCCC--- | 30.79 | 19880383 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KNAT4_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KNAT4_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KNAT4_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| APA1_ARATH | APA1 | physical | 15781858 | |
| OFP12_ARATH | OFP12 | physical | 15781858 | |
| OFP4_ARATH | OFP4 | physical | 15781858 | |
| OFP1_ARATH | OFP1 | physical | 15781858 | |
| OFP2_ARATH | OFP2 | physical | 15781858 | |
| KNAT7_ARATH | KNAT7 | physical | 15781858 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...