dbPTM

KNAT4_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	KNAT4_ARATH
UniProt AC	P48001
Protein Name	Homeobox protein knotted-1-like 4
Gene Name	KNAT4
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	393
Subcellular Localization	Nucleus .
Protein Description
Protein Sequence	MAFHNNHFNHFTDQQQHQPPPPPQQQQQQHFQESAPPNWLLRSDNNFLNLHTAASAAATSSDSPSSAAANQWLSRSSSFLQRGNTANNNNNETSGDVIEDVPGGEESMIGEKKEAERWQNARHKAEILSHPLYEQLLSAHVACLRIATPVDQLPRIDAQLAQSQNVVAKYSTLEAAQGLLAGDDKELDHFMTHYVLLLCSFKEQLQQHVRVHAMEAVMACWEIEQSLQSFTGVSPGEGTGATMSEDEDEQVESDAHLFDGSLDGLGFGPLVPTESERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKSWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVSKNKRRSNAGENSGRDR

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
76	Phosphorylation	ANQWLSRSSSFLQRG HHHHHHHCHHHHHHC	27.27	28011693
77	Phosphorylation	NQWLSRSSSFLQRGN HHHHHHCHHHHHHCC	24.81	30407730
78	Phosphorylation	QWLSRSSSFLQRGNT HHHHHCHHHHHHCCC	31.09	30291188
389	Phosphorylation	RSNAGENSGRDR--- CCCCCCCCCCCC---	30.79	19880383

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of KNAT4_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of KNAT4_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of KNAT4_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
APA1_ARATH	APA1	physical	15781858
OFP12_ARATH	OFP12	physical	15781858
OFP4_ARATH	OFP4	physical	15781858
OFP1_ARATH	OFP1	physical	15781858
OFP2_ARATH	OFP2	physical	15781858
KNAT7_ARATH	KNAT7	physical	15781858

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of KNAT4_ARATH

Related Literatures of Post-Translational Modification