UniProt ID | OFP12_ARATH | |
---|---|---|
UniProt AC | F4I8R6 | |
Protein Name | Transcription repressor OFP12 | |
Gene Name | OFP12 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 226 | |
Subcellular Localization | Nucleus. | |
Protein Description | Transcriptional repressor that regulates multiple aspects of plant growth and development through the regulation of BEL1-LIKE (BLH) and KNOX TALE (KNAT) homeodomain transcription factors.. | |
Protein Sequence | MPRVMWKNFHLCFPSNLTKPSSSPSGATSDDPNRPSILLINNFNLLYDDSSAAHRRLSKPLIHDVEPSSTFTASTSTAANSSSSSASYDDSDNYGFAPDDDSPPPDLTAVLASRRFFFSSPGCSNSITDSPDLRCRDNYDTATRLLTGGTAVKHYVQSPDPYNDFRRSMQEMIDAVTNAGDLRRYEFLHELLLSYLSLNAADTHKFIIRAFADILVSLLSDGHRIS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
185 | Phosphorylation | NAGDLRRYEFLHELL HHHHHHHHHHHHHHH | 28295753 | ||
194 | Phosphorylation | FLHELLLSYLSLNAA HHHHHHHHHHCCCCH | 28295753 | ||
195 | Phosphorylation | LHELLLSYLSLNAAD HHHHHHHHHCCCCHH | 28295753 | ||
197 | Phosphorylation | ELLLSYLSLNAADTH HHHHHHHCCCCHHHH | 28295753 | ||
203 | Phosphorylation | LSLNAADTHKFIIRA HCCCCHHHHHHHHHH | 28295753 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of OFP12_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of OFP12_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of OFP12_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of OFP12_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...