UniProt ID | KLF7_HUMAN | |
---|---|---|
UniProt AC | O75840 | |
Protein Name | Krueppel-like factor 7 | |
Gene Name | KLF7 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 302 | |
Subcellular Localization | Nucleus . | |
Protein Description | Transcriptional activator. Binds in vitro to the CACCC motif of the beta-globin promoter and to the SP1 recognition sequence.. | |
Protein Sequence | MDVLASYSIFQELQLVHDTGYFSALPSLEETWQQTCLELERYLQTEPRRISETFGEDLDCFLHASPPPCIEESFRRLDPLLLPVEAAICEKSSAVDILLSRDKLLSETCLSLQPASSSLDSYTAVNQAQLNAVTSLTPPSSPELSRHLVKTSQTLSAVDGTVTLKLVAKKAALSSVKVGGVATAAAAVTAAGAVKSGQSDSDQGGLGAEACPENKKRVHRCQFNGCRKVYTKSSHLKAHQRTHTGEKPYKCSWEGCEWRFARSDELTRHYRKHTGAKPFKCNHCDRCFSRSDHLALHMKRHI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 (in isoform 2) | Phosphorylation | - | 44.10 | 23663014 | |
9 (in isoform 2) | Phosphorylation | - | 2.91 | 23663014 | |
42 | Phosphorylation | TCLELERYLQTEPRR HHHHHHHHHHCCCCH | 8.19 | 23663014 | |
45 | Phosphorylation | ELERYLQTEPRRISE HHHHHHHCCCCHHHH | 45.41 | - | |
151 | Phosphorylation | LSRHLVKTSQTLSAV HHHHHHHHCCCCCCC | 20.70 | 22210691 | |
189 | Phosphorylation | ATAAAAVTAAGAVKS HHHHHHHHHHHHHHC | 13.18 | - | |
196 | Phosphorylation | TAAGAVKSGQSDSDQ HHHHHHHCCCCCCCC | 35.15 | - | |
199 | Phosphorylation | GAVKSGQSDSDQGGL HHHHCCCCCCCCCCC | 42.48 | - | |
201 | Phosphorylation | VKSGQSDSDQGGLGA HHCCCCCCCCCCCCC | 36.76 | - | |
232 | Acetylation | GCRKVYTKSSHLKAH CCCEEEECCHHHHHH | 32.07 | 16230382 | |
237 | Acetylation | YTKSSHLKAHQRTHT EECCHHHHHHCCCCC | 38.10 | 16230382 | |
242 | Phosphorylation | HLKAHQRTHTGEKPY HHHHHCCCCCCCCCC | 19.74 | 28348404 | |
244 | Phosphorylation | KAHQRTHTGEKPYKC HHHCCCCCCCCCCCC | 46.56 | 26270265 | |
247 | Ubiquitination | QRTHTGEKPYKCSWE CCCCCCCCCCCCCCC | 55.80 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KLF7_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KLF7_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KLF7_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
FBX38_HUMAN | FBXO38 | physical | 14729953 | |
A4_HUMAN | APP | physical | 21832049 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...