UniProt ID | KI3L1_HUMAN | |
---|---|---|
UniProt AC | P43629 | |
Protein Name | Killer cell immunoglobulin-like receptor 3DL1 | |
Gene Name | KIR3DL1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 444 | |
Subcellular Localization |
Cell membrane Single-pass type I membrane protein. |
|
Protein Description | Receptor on natural killer (NK) cells for HLA Bw4 allele. Inhibits the activity of NK cells thus preventing cell lysis.. | |
Protein Sequence | MSLMVVSMACVGLFLVQRAGPHMGGQDKPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFMLYKEDRIHIPIFHGRIFQESFNMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPVVIMVTGNHRKPSLLAHPGPLVKSGERVILQCWSDIMFEHFFLHKEGISKDPSRLVGQIHDGVSKANFSIGPMMLALAGTYRCYGSVTHTPYQLSAPSDPLDIVVTGPYEKPSLSAQPGPKVQAGESVTLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADFPLGPATHGGTYRCFGSFRHSPYEWSDPSDPLLVSVTGNPSSSWPSPTEPSSKSGNPRHLHILIGTSVVIILFILLLFFLLHLWCSNKKNAAVMDQEPAGNRTANSEDSDEQDPEEVTYAQLDHCVFTQRKITRPSQRPKTPPTDTILYTELPNAKPRSKVVSCP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
92 | N-linked_Glycosylation | VTTAHAGNYTCRGSH CCEECCCCEEECCCC | 29.71 | 22020283 | |
102 | Phosphorylation | CRGSHPHSPTGWSAP ECCCCCCCCCCCCCC | 28.71 | 23532336 | |
118 | Phosphorylation | NPVVIMVTGNHRKPS CCEEEEEECCCCCCH | 18.19 | 23532336 | |
179 | N-linked_Glycosylation | HDGVSKANFSIGPMM CCCCCCCCCCHHHHH | 34.63 | 22020283 | |
223 | Sumoylation | VVTGPYEKPSLSAQP EEECCCCCCCCCCCC | 33.78 | - | |
225 | Phosphorylation | TGPYEKPSLSAQPGP ECCCCCCCCCCCCCC | 46.13 | 28302921 | |
227 | Phosphorylation | PYEKPSLSAQPGPKV CCCCCCCCCCCCCCC | 29.24 | 28302921 | |
245 | Phosphorylation | ESVTLSCSSRSSYDM CCEEEEECCCCCEEC | 25.96 | - | |
246 | Phosphorylation | SVTLSCSSRSSYDMY CEEEEECCCCCEECC | 40.27 | - | |
273 | N-linked_Glycosylation | LPAVRKVNRTFQADF CHHHHCCCCEEECCC | 40.07 | 22020283 | |
296 | Phosphorylation | GTYRCFGSFRHSPYE CCEEEEEECCCCCCC | 10.00 | 11733001 | |
385 | Phosphorylation | AGNRTANSEDSDEQD CCCCCCCCCCCCCCC | 40.07 | 17911614 | |
388 | Phosphorylation | RTANSEDSDEQDPEE CCCCCCCCCCCCHHH | 38.71 | 17911614 | |
415 | Phosphorylation | QRKITRPSQRPKTPP CCCCCCHHHCCCCCC | 35.21 | 17911614 | |
420 | Phosphorylation | RPSQRPKTPPTDTIL CHHHCCCCCCCCCEE | 36.86 | 17911614 | |
423 | Phosphorylation | QRPKTPPTDTILYTE HCCCCCCCCCEEEEE | 47.15 | 29978859 | |
425 | Phosphorylation | PKTPPTDTILYTELP CCCCCCCCEEEEECC | 18.50 | 29978859 | |
428 | Phosphorylation | PPTDTILYTELPNAK CCCCCEEEEECCCCC | 8.36 | 29978859 | |
429 | Phosphorylation | PTDTILYTELPNAKP CCCCEEEEECCCCCC | 27.83 | 24719451 | |
442 | Phosphorylation | KPRSKVVSCP----- CCCCCCCCCC----- | 24.53 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
385 | S | Phosphorylation | Kinase | CSNK2A1 | P68400 | GPS |
385 | S | Phosphorylation | Kinase | CSNK1D | P48730 | GPS |
388 | S | Phosphorylation | Kinase | CSNK2A1 | P68400 | GPS |
388 | S | Phosphorylation | Kinase | CSNK1D | P48730 | GPS |
415 | S | Phosphorylation | Kinase | PRKCA | P17252 | GPS |
415 | S | Phosphorylation | Kinase | PRKCB | P05771-2 | GPS |
415 | S | Phosphorylation | Kinase | PRKCE | Q02156 | GPS |
415 | S | Phosphorylation | Kinase | PRKCG | P05129 | GPS |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KI3L1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KI3L1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
KS6B1_HUMAN | RPS6KB1 | physical | 21988832 | |
KI2L2_HUMAN | KIR2DL2 | physical | 26186194 | |
F1142_HUMAN | FAM114A2 | physical | 26186194 | |
KI2L2_HUMAN | KIR2DL2 | physical | 28514442 | |
F1142_HUMAN | FAM114A2 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...