KCD11_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: KCD11_HUMAN
• UniProt AC: Q693B1
• Protein Name: BTB/POZ domain-containing protein KCTD11
• Gene Name: KCTD11
• Organism: Homo sapiens (Human).
• Sequence Length: 232
• Protein Description: Plays a role as a marker and a regulator of neuronal differentiation; Up-regulated by a variety of neurogenic signals, such as retinoic acid, epidermal growth factor/EGF and NGFB/nerve growth factor. Induces apoptosis, growth arrest and the expression of cyclin-dependent kinase inhibitor CDKN1B. Plays a role as a tumor repressor and inhibits cell growth and tumorigenicity of medulloblastoma (MDB). Acts as probable substrate-specific adapter for a BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex towards HDAC1. Functions as antagonist of the Hedgehog pathway on cell proliferation and differentiation by affecting the nuclear transfer of transcription factor GLI1, thus maintaining cerebellar granule cells in undifferentiated state, this effect probably occurs via HDAC1 down-regulation, keeping GLI1 acetylated and inactive. When knock-down, Hedgehog antagonism is impaired and proliferation of granule cells is sustained. Activates the caspase cascade..
• Protein Sequence: MLGAMFRAGTPMPPNLNSQGGGHYFIDRDGKAFRHILNFLRLGRLDLPRGYGETALLRAEADFYQIRPLLDALRELEASQGTPAPTAALLHADVDVSPRLVHFSARRGPHHYELSSVQVDTFRANLFCTDSECLGALRARFGVASGDRAEGSPHFHLEWAPRPVELPEVEYGRLGLQPLWTGGPGERREVVGTPSFLEEVLRVALEHGFRLDSVFPDPEDLLNSRSLRFVRH

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
51	Phosphorylation	RLDLPRGYGETALLR CCCCCCCCCHHHHHH	17.05	28796482
54	Phosphorylation	LPRGYGETALLRAEA CCCCCCHHHHHHHCC	20.45	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of KCD11_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of KCD11_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of KCD11_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
HDAC1_HUMAN	HDAC1	physical	20081843
CUL3_HUMAN	CUL3	physical	20081843
CUL3_HUMAN	CUL3	physical	21237243
KCD11_HUMAN	KCTD11	physical	21237243
CUL3_HUMAN	CUL3	physical	25974686

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.