| UniProt ID | IL10_HUMAN | |
|---|---|---|
| UniProt AC | P22301 | |
| Protein Name | Interleukin-10 | |
| Gene Name | IL10 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 178 | |
| Subcellular Localization | Secreted. | |
| Protein Description | Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells.. | |
| Protein Sequence | MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 134 | N-linked_Glycosylation | HRFLPCENKSKAVEQ HHHCCCCCHHHHHHH | 61.69 | UniProtKB CARBOHYD |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IL10_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IL10_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IL10_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| I10R1_HUMAN | IL10RA | physical | 11485736 | |
| I10R1_HUMAN | IL10RA | physical | 7759550 | |
| IL10_HUMAN | IL10 | physical | 8590020 | |
| I10R1_HUMAN | IL10RA | physical | 11717514 | |
| I10R1_HUMAN | IL10RA | physical | 10231374 | |
| A2MG_HUMAN | A2M | physical | 25241761 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...