UniProt ID | IL10_HUMAN | |
---|---|---|
UniProt AC | P22301 | |
Protein Name | Interleukin-10 | |
Gene Name | IL10 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 178 | |
Subcellular Localization | Secreted. | |
Protein Description | Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells.. | |
Protein Sequence | MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
134 | N-linked_Glycosylation | HRFLPCENKSKAVEQ HHHCCCCCHHHHHHH | 61.69 | UniProtKB CARBOHYD |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IL10_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IL10_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IL10_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
I10R1_HUMAN | IL10RA | physical | 11485736 | |
I10R1_HUMAN | IL10RA | physical | 7759550 | |
IL10_HUMAN | IL10 | physical | 8590020 | |
I10R1_HUMAN | IL10RA | physical | 11717514 | |
I10R1_HUMAN | IL10RA | physical | 10231374 | |
A2MG_HUMAN | A2M | physical | 25241761 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...