| UniProt ID | IFNE_HUMAN | |
|---|---|---|
| UniProt AC | Q86WN2 | |
| Protein Name | Interferon epsilon | |
| Gene Name | IFNE | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 208 | |
| Subcellular Localization | Secreted . | |
| Protein Description | Type I interferon required for maintaining basal levels of IFN-regulated genes, including 2'-5'-oligoadenylate synthetase, IRF7 and ISG15, in the female reproductive tract. Directly mediates protection against viral and bacterial genital infections (By similarity).. | |
| Protein Sequence | MIIKHFFGTVLVLLASTTIFSLDLKLIIFQQRQVNQESLKLLNKLQTLSIQQCLPHRKNFLLPQKSLSPQQYQKGHTLAILHEMLQQIFSLFRANISLDGWEENHTEKFLIQLHQQLEYLEALMGLEAEKLSGTLGSDNLRLQVKMYFRRIHDYLENQDYSTCAWAIVQVEISRCLFFVFSLTEKLSKQGRPLNDMKQELTTEFRSPR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 95 | N-linked_Glycosylation | IFSLFRANISLDGWE HHHHHHCCCCCCCCC | 21.81 | UniProtKB CARBOHYD | |
| 104 | N-linked_Glycosylation | SLDGWEENHTEKFLI CCCCCCHHHHHHHHH | 35.55 | UniProtKB CARBOHYD | |
| 134 | Phosphorylation | EAEKLSGTLGSDNLR CHHHHCCCCCCCCHH | 25.27 | - | |
| 147 | Phosphorylation | LRLQVKMYFRRIHDY HHHHHHHHHHHHHHH | 6.55 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IFNE_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IFNE_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IFNE_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| F198A_HUMAN | FAM198A | physical | 28514442 | |
| GPR98_HUMAN | GPR98 | physical | 28514442 | |
| FAT4_HUMAN | FAT4 | physical | 28514442 | |
| BACE2_HUMAN | BACE2 | physical | 28514442 | |
| CD109_HUMAN | CD109 | physical | 28514442 | |
| ANAG_HUMAN | NAGLU | physical | 28514442 | |
| FAT1_HUMAN | FAT1 | physical | 28514442 | |
| FRAS1_HUMAN | FRAS1 | physical | 28514442 | |
| LARG2_HUMAN | GYLTL1B | physical | 28514442 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
