UniProt ID | IFNE_HUMAN | |
---|---|---|
UniProt AC | Q86WN2 | |
Protein Name | Interferon epsilon | |
Gene Name | IFNE | |
Organism | Homo sapiens (Human). | |
Sequence Length | 208 | |
Subcellular Localization | Secreted . | |
Protein Description | Type I interferon required for maintaining basal levels of IFN-regulated genes, including 2'-5'-oligoadenylate synthetase, IRF7 and ISG15, in the female reproductive tract. Directly mediates protection against viral and bacterial genital infections (By similarity).. | |
Protein Sequence | MIIKHFFGTVLVLLASTTIFSLDLKLIIFQQRQVNQESLKLLNKLQTLSIQQCLPHRKNFLLPQKSLSPQQYQKGHTLAILHEMLQQIFSLFRANISLDGWEENHTEKFLIQLHQQLEYLEALMGLEAEKLSGTLGSDNLRLQVKMYFRRIHDYLENQDYSTCAWAIVQVEISRCLFFVFSLTEKLSKQGRPLNDMKQELTTEFRSPR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
95 | N-linked_Glycosylation | IFSLFRANISLDGWE HHHHHHCCCCCCCCC | 21.81 | UniProtKB CARBOHYD | |
104 | N-linked_Glycosylation | SLDGWEENHTEKFLI CCCCCCHHHHHHHHH | 35.55 | UniProtKB CARBOHYD | |
134 | Phosphorylation | EAEKLSGTLGSDNLR CHHHHCCCCCCCCHH | 25.27 | - | |
147 | Phosphorylation | LRLQVKMYFRRIHDY HHHHHHHHHHHHHHH | 6.55 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IFNE_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IFNE_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IFNE_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
F198A_HUMAN | FAM198A | physical | 28514442 | |
GPR98_HUMAN | GPR98 | physical | 28514442 | |
FAT4_HUMAN | FAT4 | physical | 28514442 | |
BACE2_HUMAN | BACE2 | physical | 28514442 | |
CD109_HUMAN | CD109 | physical | 28514442 | |
ANAG_HUMAN | NAGLU | physical | 28514442 | |
FAT1_HUMAN | FAT1 | physical | 28514442 | |
FRAS1_HUMAN | FRAS1 | physical | 28514442 | |
LARG2_HUMAN | GYLTL1B | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...