IBP1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: IBP1_SCHPO
• UniProt AC: Q8WZK3
• Protein Name: Dual specificity phosphatase ibp1
• Gene Name: ibp1
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 138
• Subcellular Localization: Cytoplasm . Nucleus .
• Protein Description: May play a role in DNA replication checkpoint via regulation of hsk1 or may act downstream of hsk1 in an S phase regulatory pathway..
• Protein Sequence: MSTLSYVSPDALKGWLMESPNEISIIDVRDYDYEGERIPGSVRIPSDTFLASVDQHVDDLMKKRSLIVHCTYSQVRGPKAARVLSEILRNRITESKEKLSLSQKEKLFQNLPTVYILHGGFSAWKRRYGGQQGLIEYD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
102	Phosphorylation	SKEKLSLSQKEKLFQ CHHHCCHHHHHHHHH	35.51	29996109

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of IBP1_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of IBP1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of IBP1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RAD21_SCHPO	rad21	genetic	14508607
ALG12_SCHPO	alg12	genetic	22681890
YIDH_SCHPO	SPAC227.17c	genetic	22681890
VPS72_SCHPO	swc2	genetic	22681890
ASK1_SCHPO	ask1	genetic	22681890
TOM70_SCHPO	tom70	genetic	22681890
RL21B_SCHPO	rpl2102	genetic	22681890
QOR_SCHPO	zta1	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.