UniProt ID | IBP1_SCHPO | |
---|---|---|
UniProt AC | Q8WZK3 | |
Protein Name | Dual specificity phosphatase ibp1 | |
Gene Name | ibp1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 138 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | May play a role in DNA replication checkpoint via regulation of hsk1 or may act downstream of hsk1 in an S phase regulatory pathway.. | |
Protein Sequence | MSTLSYVSPDALKGWLMESPNEISIIDVRDYDYEGERIPGSVRIPSDTFLASVDQHVDDLMKKRSLIVHCTYSQVRGPKAARVLSEILRNRITESKEKLSLSQKEKLFQNLPTVYILHGGFSAWKRRYGGQQGLIEYD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
102 | Phosphorylation | SKEKLSLSQKEKLFQ CHHHCCHHHHHHHHH | 35.51 | 29996109 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IBP1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IBP1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IBP1_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RAD21_SCHPO | rad21 | genetic | 14508607 | |
ALG12_SCHPO | alg12 | genetic | 22681890 | |
YIDH_SCHPO | SPAC227.17c | genetic | 22681890 | |
VPS72_SCHPO | swc2 | genetic | 22681890 | |
ASK1_SCHPO | ask1 | genetic | 22681890 | |
TOM70_SCHPO | tom70 | genetic | 22681890 | |
RL21B_SCHPO | rpl2102 | genetic | 22681890 | |
QOR_SCHPO | zta1 | physical | 26771498 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...