HRSL5_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: HRSL5_HUMAN
• UniProt AC: Q96KN8
• Protein Name: Ca(2+)-independent N-acyltransferase
• Gene Name: HRASLS5
• Organism: Homo sapiens (Human).
• Sequence Length: 279
• Protein Description: catalyzes N-acylation of phosphatidylethanolamine (PE) to generate N-Acylphosphatidylethanolamine (NAPE) a precursor of bioactive N-acylethanolamines, including the endocannabinoid anandamide..
• Protein Sequence: MGLSPGAEGEYALRLPRIPPPLPKPASRTASTGPKDQPPALRRSAVPHSGLNSISPLELEESVGFAALVQLPAKQPPPGTLEQGRSIQQGEKAVVSLETTPSQKADWSSIPKPENEGKLIKQAAEGKPRPRPGDLIEIFRIGYEHWAIYVEDDCVVHLAPPSEEFEVGSITSIFSNRAVVKYSRLEDVLHGCSWKVNNKLDGTYLPLPVDKIIQRTKKMVNKIVQYSLIEGNCEHFVNGLRYGVPRSQQVEHALMEGAKAAGAVISAVVDSIKPKPITA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
70 (in isoform 3)	Phosphorylation	-	42.45	-
241 (in isoform 2)	Phosphorylation	-	27.79	-
246 (in isoform 2)	Phosphorylation	-	44.70	-
247 (in isoform 2)	Phosphorylation	-	20.92	-
250 (in isoform 2)	Phosphorylation	-	4.51	-
252 (in isoform 2)	Phosphorylation	-	25.88	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of HRSL5_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of HRSL5_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of HRSL5_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
A4_HUMAN	APP	physical	21832049
VCIP1_HUMAN	VCPIP1	physical	26186194
VCIP1_HUMAN	VCPIP1	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.