UniProt ID | HRG1_HUMAN | |
---|---|---|
UniProt AC | Q6P1K1 | |
Protein Name | Heme transporter HRG1 | |
Gene Name | SLC48A1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 146 | |
Subcellular Localization |
Endosome membrane Multi-pass membrane protein . Lysosome membrane Multi-pass membrane protein . |
|
Protein Description | Heme transporter that regulates intracellular heme availability through the endosomal or lysosomal compartment.. | |
Protein Sequence | MAPSRLQLGLRAAYSGISSVAGFSIFLVWTVVYRQPGTAAMGGLAGVLALWVLVTHVMYMQDYWRTWLKGLRGFFFVGVLFSAVSIAAFCTFLVLAITRHQSLTDPTSYYLSSVWSFISFKWAFLLSLYAHRYRADFADISILSDF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
38 | Phosphorylation | VVYRQPGTAAMGGLA EHHCCCCCHHHHHHH | 20.23 | 24043423 | |
55 | Phosphorylation | LALWVLVTHVMYMQD HHHHHHHHHHHHHHH | 12.46 | 24043423 | |
59 | Phosphorylation | VLVTHVMYMQDYWRT HHHHHHHHHHHHHHH | 7.19 | 24043423 | |
63 | Phosphorylation | HVMYMQDYWRTWLKG HHHHHHHHHHHHHHH | 4.66 | 24043423 | |
119 | Phosphorylation | SSVWSFISFKWAFLL HHHHHHHHHHHHHHH | 20.82 | 24719451 | |
141 | Phosphorylation | RADFADISILSDF-- CCCCCCCHHHCCC-- | 20.30 | 29691806 | |
144 | Phosphorylation | FADISILSDF----- CCCCHHHCCC----- | 34.99 | 29691806 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HRG1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HRG1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HRG1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
A4_HUMAN | APP | physical | 21832049 | |
NDKB_HUMAN | NME2 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...