UniProt ID | HDHD3_HUMAN | |
---|---|---|
UniProt AC | Q9BSH5 | |
Protein Name | Haloacid dehalogenase-like hydrolase domain-containing protein 3 | |
Gene Name | HDHD3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 251 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MAHRLQIRLLTWDVKDTLLRLRHPLGEAYATKARAHGLEVEPSALEQGFRQAYRAQSHSFPNYGLSHGLTSRQWWLDVVLQTFHLAGVQDAQAVAPIAEQLYKDFSHPCTWQVLDGAEDTLRECRTRGLRLAVISNFDRRLEGILGGLGLREHFDFVLTSEAAGWPKPDPRIFQEALRLAHMEPVVAAHVGDNYLCDYQGPRAVGMHSFLVVGPQALDPVVRDSVPKEHILPSLAHLLPALDCLEGSTPGL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
15 | Acetylation | RLLTWDVKDTLLRLR EEEECCHHHHHHHHH | 42.39 | 19608861 | |
15 | Succinylation | RLLTWDVKDTLLRLR EEEECCHHHHHHHHH | 42.39 | - | |
15 | Ubiquitination | RLLTWDVKDTLLRLR EEEECCHHHHHHHHH | 42.39 | 19608861 | |
15 | Malonylation | RLLTWDVKDTLLRLR EEEECCHHHHHHHHH | 42.39 | 26320211 | |
15 | Succinylation | RLLTWDVKDTLLRLR EEEECCHHHHHHHHH | 42.39 | 27452117 | |
32 | Ubiquitination | LGEAYATKARAHGLE HHHHHHHHHHHCCCC | 27.92 | 21906983 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HDHD3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HDHD3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HDHD3_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PCH2_HUMAN | TRIP13 | physical | 19060904 | |
PREP_HUMAN | PITRM1 | physical | 26344197 | |
MTD2L_HUMAN | MTHFD2L | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions."; Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.; Science 325:834-840(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-15, AND MASS SPECTROMETRY. |