UniProt ID | MTD2L_HUMAN | |
---|---|---|
UniProt AC | Q9H903 | |
Protein Name | Probable bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase 2 | |
Gene Name | MTHFD2L | |
Organism | Homo sapiens (Human). | |
Sequence Length | 347 | |
Subcellular Localization |
Mitochondrion inner membrane Peripheral membrane protein Matrix side. |
|
Protein Description | ||
Protein Sequence | MTVPVRGFSLLRGRLGRAPALGRSTAPSVRAPGEPGSAFRGFRSSGVRHEAIIISGTEMAKHIQKEIQRGVESWVSLGNRRPHLSIILVGDNPASHTYVRNKIRAASAVGICSELILKPKDVSQEELLDVTDQLNMDPRVSGILVQLPLPDHVDERTICNGIAPEKDVDGFHIINIGRLCLDQHSLIPATASAVWEIIKRTGIQTFGKNVVVAGRSKNVGMPIAMLLHTDGEHERPGGDATVTIAHRYTPKEQLKIHTQLADIIIVAAGIPKLITSDMVKEGAAVIDVGINYVHDPVTGKTKLVGDVDFEAVKKKAGFITPVPGGVGPMTVAMLLKNTLLAAKKIIY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
61 | Acetylation | ISGTEMAKHIQKEIQ EECHHHHHHHHHHHH | 39.67 | 25953088 | |
65 | Acetylation | EMAKHIQKEIQRGVE HHHHHHHHHHHHHHH | 57.07 | 25953088 | |
65 | Ubiquitination | EMAKHIQKEIQRGVE HHHHHHHHHHHHHHH | 57.07 | - | |
73 | Phosphorylation | EIQRGVESWVSLGNR HHHHHHHHHHHCCCC | 30.30 | 26852163 | |
76 | Phosphorylation | RGVESWVSLGNRRPH HHHHHHHHCCCCCCC | 25.05 | 26852163 | |
201 | Phosphorylation | VWEIIKRTGIQTFGK HHHHHHHHCCCCCCC | 33.37 | - | |
320 | Phosphorylation | KKKAGFITPVPGGVG HHHCCEEECCCCCCC | 18.90 | - | |
330 | Phosphorylation | PGGVGPMTVAMLLKN CCCCCHHHHHHHHHH | 14.30 | 29396449 | |
343 | Acetylation | KNTLLAAKKIIY--- HHHHHHHHHHCC--- | 38.61 | 25953088 | |
343 | Succinylation | KNTLLAAKKIIY--- HHHHHHHHHHCC--- | 38.61 | 23954790 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MTD2L_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MTD2L_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MTD2L_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CYTS_HUMAN | CST4 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...