UniProt ID | H2AZ_MOUSE | |
---|---|---|
UniProt AC | P0C0S6 | |
Protein Name | Histone H2A.Z | |
Gene Name | H2afz | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 128 | |
Subcellular Localization | Nucleus . Chromosome . Enriched in constitutive heterochromatin (PubMed:12660166, PubMed:15195148). Absent from facultative heterochromatin of the inactive X chromosome (PubMed:12660166). | |
Protein Description | Variant histone H2A which replaces conventional H2A in a subset of nucleosomes. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. May be involved in the formation of constitutive heterochromatin. May be required for chromosome segregation during cell division. Essential for early development.. | |
Protein Sequence | MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Methylation | ---MAGGKAGKDSGK ---CCCCCCCCCCCC | 53.71 | - | |
5 | Acetylation | ---MAGGKAGKDSGK ---CCCCCCCCCCCC | 53.71 | 16204459 | |
8 | Acetylation | MAGGKAGKDSGKAKT CCCCCCCCCCCCCCC | 54.29 | 16204459 | |
8 | Methylation | MAGGKAGKDSGKAKT CCCCCCCCCCCCCCC | 54.29 | - | |
12 | Acetylation | KAGKDSGKAKTKAVS CCCCCCCCCCCHHCC | 51.14 | 16204459 | |
12 | Lactoylation | KAGKDSGKAKTKAVS CCCCCCCCCCCHHCC | 51.14 | 31645732 | |
14 | Lactoylation | GKDSGKAKTKAVSRS CCCCCCCCCHHCCHH | 54.78 | - | |
14 | Acetylation | GKDSGKAKTKAVSRS CCCCCCCCCHHCCHH | 54.78 | 23864654 | |
99 | Phosphorylation | RGDEELDSLIKATIA CCCHHHHHHHHHHHC | 44.62 | 28066266 | |
102 | Acetylation | EELDSLIKATIAGGG HHHHHHHHHHHCCCC | 44.78 | 23806337 | |
102 | Succinylation | EELDSLIKATIAGGG HHHHHHHHHHHCCCC | 44.78 | 23806337 | |
116 | Acetylation | GVIPHIHKSLIGKKG CCCHHHHHHHCCCCC | 46.48 | 23806337 | |
116 | Ubiquitination | GVIPHIHKSLIGKKG CCCHHHHHHHCCCCC | 46.48 | - | |
116 | Lactoylation | GVIPHIHKSLIGKKG CCCHHHHHHHCCCCC | 46.48 | 31645732 | |
117 | Phosphorylation | VIPHIHKSLIGKKGQ CCHHHHHHHCCCCCC | 15.85 | - | |
121 | Ubiquitination | IHKSLIGKKGQQKTV HHHHHCCCCCCCCCC | 46.89 | - | |
122 | Ubiquitination | HKSLIGKKGQQKTV- HHHHCCCCCCCCCC- | 57.66 | - | |
126 | Ubiquitination | IGKKGQQKTV----- CCCCCCCCCC----- | 43.28 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of H2AZ_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
5 | K | Acetylation |
| 16204459 |
5 | K | Acetylation |
| 16204459 |
5 | K | Methylation |
| 16204459 |
5 | K | Methylation |
| 16204459 |
8 | K | Acetylation |
| 16204459 |
8 | K | Acetylation |
| 16204459 |
8 | K | Methylation |
| 16204459 |
8 | K | Methylation |
| 16204459 |
12 | K | Acetylation |
| 16204459 |
12 | K | Acetylation |
| 16204459 |
14 | K | Acetylation |
| 7217105 |
122 | K | ubiquitylation |
| - |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of H2AZ_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
H2AZ_MOUSE | H2afz | physical | 11101893 | |
H2B11_XENLA | hist1h2bj | physical | 11101893 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...