| UniProt ID | GTSF1_HUMAN | |
|---|---|---|
| UniProt AC | Q8WW33 | |
| Protein Name | Gametocyte-specific factor 1 | |
| Gene Name | GTSF1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 167 | |
| Subcellular Localization | Cytoplasm . | |
| Protein Description | Required for spermatogenesis and is involved in the suppression of retrotransposon transcription in male germ cells.. | |
| Protein Sequence | MEETYTDSLDPEKLLQCPYDKNHQIRACRFPYHLIKCRKNHPDVASKLATCPFNARHQVPRAEISHHISSCDDRSCIEQDVVNQTRSLRQETLAESTWQCPPCDEDWDKDLWEQTSTPFVWGTTHYSDNNSPASNIVTEHKNNLASGMRVPKSLPYVLPWKNNGNAQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 5 | Phosphorylation | ---MEETYTDSLDPE ---CCCCCCCCCCHH | 16.30 | - | |
| 8 | Phosphorylation | MEETYTDSLDPEKLL CCCCCCCCCCHHHHH | 27.20 | 23186163 | |
| 32 | Phosphorylation | IRACRFPYHLIKCRK EEHHCCCHHHHHHHC | 13.42 | - | |
| 36 | Ubiquitination | RFPYHLIKCRKNHPD CCCHHHHHHHCCCCC | 34.05 | - | |
| 39 | Ubiquitination | YHLIKCRKNHPDVAS HHHHHHHCCCCCHHH | 69.91 | - | |
| 47 | Acetylation | NHPDVASKLATCPFN CCCCHHHHHCCCCCC | 32.19 | 25953088 | |
| 47 | Ubiquitination | NHPDVASKLATCPFN CCCCHHHHHCCCCCC | 32.19 | - | |
| 50 | Phosphorylation | DVASKLATCPFNARH CHHHHHCCCCCCCCC | 31.02 | - | |
| 69 | Phosphorylation | AEISHHISSCDDRSC HHHCHHCCCCCCCHH | 22.13 | 30576142 | |
| 75 | Phosphorylation | ISSCDDRSCIEQDVV CCCCCCCHHHHHHHH | 26.83 | 30576142 | |
| 87 | Phosphorylation | DVVNQTRSLRQETLA HHHHHHHHHHHHHHH | 31.15 | - | |
| 115 | Phosphorylation | DKDLWEQTSTPFVWG CHHHHHHCCCCEEEE | 24.05 | 23898821 | |
| 116 | Phosphorylation | KDLWEQTSTPFVWGT HHHHHHCCCCEEEEC | 33.50 | 23898821 | |
| 117 | Phosphorylation | DLWEQTSTPFVWGTT HHHHHCCCCEEEECC | 24.92 | 23898821 | |
| 123 | Phosphorylation | STPFVWGTTHYSDNN CCCEEEECCCCCCCC | 8.49 | 23898821 | |
| 124 | Phosphorylation | TPFVWGTTHYSDNNS CCEEEECCCCCCCCC | 18.19 | 23898821 | |
| 126 | Phosphorylation | FVWGTTHYSDNNSPA EEEECCCCCCCCCCH | 18.67 | 30576142 | |
| 127 | Phosphorylation | VWGTTHYSDNNSPAS EEECCCCCCCCCCHH | 26.68 | 30576142 | |
| 131 | Phosphorylation | THYSDNNSPASNIVT CCCCCCCCCHHHHHH | 28.26 | 30576142 | |
| 134 | Phosphorylation | SDNNSPASNIVTEHK CCCCCCHHHHHHCCC | 30.39 | 23898821 | |
| 138 | Phosphorylation | SPASNIVTEHKNNLA CCHHHHHHCCCCCCC | 28.68 | 23898821 | |
| 152 | Ubiquitination | ASGMRVPKSLPYVLP CCCCCCCCCCCCEEC | 62.86 | 21890473 | |
| 153 | Phosphorylation | SGMRVPKSLPYVLPW CCCCCCCCCCCEECC | 28.62 | 22617229 | |
| 156 | Phosphorylation | RVPKSLPYVLPWKNN CCCCCCCCEECCCCC | 21.66 | 23917254 | |
| 161 | Ubiquitination | LPYVLPWKNNGNAQ- CCCEECCCCCCCCC- | 38.30 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GTSF1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GTSF1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GTSF1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| RGP1_HUMAN | RGP1 | physical | 28514442 | |
| MK14_HUMAN | MAPK14 | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...