UniProt ID | GTSF1_HUMAN | |
---|---|---|
UniProt AC | Q8WW33 | |
Protein Name | Gametocyte-specific factor 1 | |
Gene Name | GTSF1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 167 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | Required for spermatogenesis and is involved in the suppression of retrotransposon transcription in male germ cells.. | |
Protein Sequence | MEETYTDSLDPEKLLQCPYDKNHQIRACRFPYHLIKCRKNHPDVASKLATCPFNARHQVPRAEISHHISSCDDRSCIEQDVVNQTRSLRQETLAESTWQCPPCDEDWDKDLWEQTSTPFVWGTTHYSDNNSPASNIVTEHKNNLASGMRVPKSLPYVLPWKNNGNAQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Phosphorylation | ---MEETYTDSLDPE ---CCCCCCCCCCHH | 16.30 | - | |
8 | Phosphorylation | MEETYTDSLDPEKLL CCCCCCCCCCHHHHH | 27.20 | 23186163 | |
32 | Phosphorylation | IRACRFPYHLIKCRK EEHHCCCHHHHHHHC | 13.42 | - | |
36 | Ubiquitination | RFPYHLIKCRKNHPD CCCHHHHHHHCCCCC | 34.05 | - | |
39 | Ubiquitination | YHLIKCRKNHPDVAS HHHHHHHCCCCCHHH | 69.91 | - | |
47 | Acetylation | NHPDVASKLATCPFN CCCCHHHHHCCCCCC | 32.19 | 25953088 | |
47 | Ubiquitination | NHPDVASKLATCPFN CCCCHHHHHCCCCCC | 32.19 | - | |
50 | Phosphorylation | DVASKLATCPFNARH CHHHHHCCCCCCCCC | 31.02 | - | |
69 | Phosphorylation | AEISHHISSCDDRSC HHHCHHCCCCCCCHH | 22.13 | 30576142 | |
75 | Phosphorylation | ISSCDDRSCIEQDVV CCCCCCCHHHHHHHH | 26.83 | 30576142 | |
87 | Phosphorylation | DVVNQTRSLRQETLA HHHHHHHHHHHHHHH | 31.15 | - | |
115 | Phosphorylation | DKDLWEQTSTPFVWG CHHHHHHCCCCEEEE | 24.05 | 23898821 | |
116 | Phosphorylation | KDLWEQTSTPFVWGT HHHHHHCCCCEEEEC | 33.50 | 23898821 | |
117 | Phosphorylation | DLWEQTSTPFVWGTT HHHHHCCCCEEEECC | 24.92 | 23898821 | |
123 | Phosphorylation | STPFVWGTTHYSDNN CCCEEEECCCCCCCC | 8.49 | 23898821 | |
124 | Phosphorylation | TPFVWGTTHYSDNNS CCEEEECCCCCCCCC | 18.19 | 23898821 | |
126 | Phosphorylation | FVWGTTHYSDNNSPA EEEECCCCCCCCCCH | 18.67 | 30576142 | |
127 | Phosphorylation | VWGTTHYSDNNSPAS EEECCCCCCCCCCHH | 26.68 | 30576142 | |
131 | Phosphorylation | THYSDNNSPASNIVT CCCCCCCCCHHHHHH | 28.26 | 30576142 | |
134 | Phosphorylation | SDNNSPASNIVTEHK CCCCCCHHHHHHCCC | 30.39 | 23898821 | |
138 | Phosphorylation | SPASNIVTEHKNNLA CCHHHHHHCCCCCCC | 28.68 | 23898821 | |
152 | Ubiquitination | ASGMRVPKSLPYVLP CCCCCCCCCCCCEEC | 62.86 | 21890473 | |
153 | Phosphorylation | SGMRVPKSLPYVLPW CCCCCCCCCCCEECC | 28.62 | 22617229 | |
156 | Phosphorylation | RVPKSLPYVLPWKNN CCCCCCCCEECCCCC | 21.66 | 23917254 | |
161 | Ubiquitination | LPYVLPWKNNGNAQ- CCCEECCCCCCCCC- | 38.30 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GTSF1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GTSF1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GTSF1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RGP1_HUMAN | RGP1 | physical | 28514442 | |
MK14_HUMAN | MAPK14 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...