| UniProt ID | GSTO2_HUMAN | |
|---|---|---|
| UniProt AC | Q9H4Y5 | |
| Protein Name | Glutathione S-transferase omega-2 | |
| Gene Name | GSTO2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 243 | |
| Subcellular Localization | ||
| Protein Description | Exhibits glutathione-dependent thiol transferase activity. Has high dehydroascorbate reductase activity and may contribute to the recycling of ascorbic acid. Participates in the biotransformation of inorganic arsenic and reduces monomethylarsonic acid (MMA).. | |
| Protein Sequence | MSGDATRTLGKGSQPPGPVPEGLIRIYSMRFCPYSHRTRLVLKAKDIRHEVVNINLRNKPEWYYTKHPFGHIPVLETSQCQLIYESVIACEYLDDAYPGRKLFPYDPYERARQKMLLELFCKVPHLTKECLVALRCGRECTNLKAALRQEFSNLEEILEYQNTTFFGGTCISMIDYLLWPWFERLDVYGILDCVSHTPALRLWISAMKWDPTVCALLMDKSIFQGFLNLYFQNNPNAFDFGLC | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 11 | Ubiquitination | DATRTLGKGSQPPGP CCCCCCCCCCCCCCC | 59.51 | 22817900 | |
| 27 | Phosphorylation | PEGLIRIYSMRFCPY CCHHEEEEEEEECCC | 6.12 | - | |
| 28 | Phosphorylation | EGLIRIYSMRFCPYS CHHEEEEEEEECCCC | 10.91 | - | |
| 31 | Ubiquitination | IRIYSMRFCPYSHRT EEEEEEEECCCCCCC | 3.54 | 22817900 | |
| 59 | Ubiquitination | VNINLRNKPEWYYTK EEEECCCCCEEEEEC | 37.57 | 21906983 | |
| 73 | Ubiquitination | KHPFGHIPVLETSQC CCCCCCCCEECCCHH | 20.97 | 22817900 | |
| 100 | Ubiquitination | LDDAYPGRKLFPYDP CCCCCCCCCCCCCCH | 28.18 | 29967540 | |
| 101 | Ubiquitination | DDAYPGRKLFPYDPY CCCCCCCCCCCCCHH | 61.47 | 22817900 | |
| 128 | Ubiquitination | CKVPHLTKECLVALR HCCCCCCHHHHHHHH | 53.44 | 29967540 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GSTO2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GSTO2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GSTO2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| GSTO2_HUMAN | GSTO2 | physical | 25416956 | |
| CNDP2_HUMAN | CNDP2 | physical | 26344197 | |
| FKB1A_HUMAN | FKBP1A | physical | 26344197 | |
| TAGL2_HUMAN | TAGLN2 | physical | 26344197 | |
| THIO_HUMAN | TXN | physical | 26344197 | |
| WDR1_HUMAN | WDR1 | physical | 26344197 | |
| EDRF1_HUMAN | EDRF1 | physical | 28514442 | |
| RBM12_HUMAN | RBM12 | physical | 28514442 | |
| CJ088_HUMAN | C10orf88 | physical | 28514442 | |
| GPX4_HUMAN | GPX4 | physical | 28514442 |
| Kegg Disease | |
|---|---|
| There are no disease associations of PTM sites. | |
| OMIM Disease | |
| There are no disease associations of PTM sites. | |
| Kegg Drug | |
| There are no disease associations of PTM sites. | |
| DrugBank | |
| DB00143 | Glutathione |
loading...
