UniProt ID | GSTO2_HUMAN | |
---|---|---|
UniProt AC | Q9H4Y5 | |
Protein Name | Glutathione S-transferase omega-2 | |
Gene Name | GSTO2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 243 | |
Subcellular Localization | ||
Protein Description | Exhibits glutathione-dependent thiol transferase activity. Has high dehydroascorbate reductase activity and may contribute to the recycling of ascorbic acid. Participates in the biotransformation of inorganic arsenic and reduces monomethylarsonic acid (MMA).. | |
Protein Sequence | MSGDATRTLGKGSQPPGPVPEGLIRIYSMRFCPYSHRTRLVLKAKDIRHEVVNINLRNKPEWYYTKHPFGHIPVLETSQCQLIYESVIACEYLDDAYPGRKLFPYDPYERARQKMLLELFCKVPHLTKECLVALRCGRECTNLKAALRQEFSNLEEILEYQNTTFFGGTCISMIDYLLWPWFERLDVYGILDCVSHTPALRLWISAMKWDPTVCALLMDKSIFQGFLNLYFQNNPNAFDFGLC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
11 | Ubiquitination | DATRTLGKGSQPPGP CCCCCCCCCCCCCCC | 59.51 | 22817900 | |
27 | Phosphorylation | PEGLIRIYSMRFCPY CCHHEEEEEEEECCC | 6.12 | - | |
28 | Phosphorylation | EGLIRIYSMRFCPYS CHHEEEEEEEECCCC | 10.91 | - | |
31 | Ubiquitination | IRIYSMRFCPYSHRT EEEEEEEECCCCCCC | 3.54 | 22817900 | |
59 | Ubiquitination | VNINLRNKPEWYYTK EEEECCCCCEEEEEC | 37.57 | 21906983 | |
73 | Ubiquitination | KHPFGHIPVLETSQC CCCCCCCCEECCCHH | 20.97 | 22817900 | |
100 | Ubiquitination | LDDAYPGRKLFPYDP CCCCCCCCCCCCCCH | 28.18 | 29967540 | |
101 | Ubiquitination | DDAYPGRKLFPYDPY CCCCCCCCCCCCCHH | 61.47 | 22817900 | |
128 | Ubiquitination | CKVPHLTKECLVALR HCCCCCCHHHHHHHH | 53.44 | 29967540 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GSTO2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GSTO2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GSTO2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GSTO2_HUMAN | GSTO2 | physical | 25416956 | |
CNDP2_HUMAN | CNDP2 | physical | 26344197 | |
FKB1A_HUMAN | FKBP1A | physical | 26344197 | |
TAGL2_HUMAN | TAGLN2 | physical | 26344197 | |
THIO_HUMAN | TXN | physical | 26344197 | |
WDR1_HUMAN | WDR1 | physical | 26344197 | |
EDRF1_HUMAN | EDRF1 | physical | 28514442 | |
RBM12_HUMAN | RBM12 | physical | 28514442 | |
CJ088_HUMAN | C10orf88 | physical | 28514442 | |
GPX4_HUMAN | GPX4 | physical | 28514442 |
Kegg Disease | |
---|---|
There are no disease associations of PTM sites. | |
OMIM Disease | |
There are no disease associations of PTM sites. | |
Kegg Drug | |
There are no disease associations of PTM sites. | |
DrugBank | |
DB00143 | Glutathione |
loading...