GRF4_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GRF4_ARATH
• UniProt AC: Q8L8A7
• Protein Name: Growth-regulating factor 4
• Gene Name: GRF4
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 380
• Subcellular Localization: Nucleus .
• Protein Description: Transcription activator that plays a role in the regulation of cell expansion in leaf and cotyledons tissues. Component of a network formed by miR396, the GRFs and their interacting factors (GIFs) acting in the regulation of meristem function, at least partially through the control of cell proliferation..
• Protein Sequence: MDLQLKQWRSQQQNESEEQGSAATKISNFFFDQIQSQTATSAAAAPLPLFVPEPTSSSSFSCFSPDSSNSSSSSRFLKMGNFFSWAQWQELELQALIYRYMLAGASVPQELLLPIKKSLLHQSPMHFLHHPLQHSFPHHQPSWYWGRGAMDPEPGRCKRTDGKKWRCSRDVVAGHKYCDRHIHRGRNRSRKPVETATTTITTTATTTASSFVLGEELGHGPNNNHFFSSGSSQPLHLSHQQSCSSEMKQESNNNKRPYEANSGFSNGRSDDGHILRHFFDDWPRSSDSTSSPMSSSTCHLSISMPGNNTSSDVSLKLSTGNEEEEENMRNNNNEREQMNWWSNGGNHHNNMGGPLAEALRSASSTSSVLHQMGISTQVFH

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of GRF4_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GRF4_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GRF4_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GRF4_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GIF1_ARATH	AN3	physical	24285851
GIF2_ARATH	GIF2	physical	24285851
GIF3_ARATH	GIF3	physical	24285851

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.