GIF3_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GIF3_ARATH
• UniProt AC: Q93VH6
• Protein Name: GRF1-interacting factor 3
• Gene Name: GIF3
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 223
• Protein Description: Transcription coactivator that plays a role in the regulation of cell expansion in leaf and cotyledons tissues (By similarity). Component of a network formed by miR396, the GRFs and their interacting factors (GIFs) acting in the regulation of meristem function, at least partially through the control of cell proliferation (By similarity). GIFs are involved in the positive regulation of cell proliferation of lateral organs in a functionally redundant manner..
• Protein Sequence: MQQSPQMIPMVLPSFPPTNNITTEQIQKYLDENKKLIMAILENQNLGKLAECAQYQALLQKNLMYLAAIADAQPQPPAATLTSGAMTPQAMAPNPSSMQPPPSYFMQQHQAVGMAQQIPPGIFPPRGPLQFGSPHQFLDPQQQLHQQAMQGHMGIRPMGLNNNNGLQHQMHHHETALAANNAGPNDASGGGKPDGTNMSQSGADGQGGSAARHGGGDAKTEGK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of GIF3_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GIF3_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GIF3_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GIF3_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GRF4_ARATH	GRF4	physical	24285851

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.