UniProt ID | GP1BB_HUMAN | |
---|---|---|
UniProt AC | P13224 | |
Protein Name | Platelet glycoprotein Ib beta chain | |
Gene Name | GP1BB | |
Organism | Homo sapiens (Human). | |
Sequence Length | 206 | |
Subcellular Localization |
Membrane Single-pass type I membrane protein. |
|
Protein Description | Gp-Ib, a surface membrane protein of platelets, participates in the formation of platelet plugs by binding to von Willebrand factor, which is already bound to the subendothelium.. | |
Protein Sequence | MGSGPRGALSLLLLLLAPPSRPAAGCPAPCSCAGTLVDCGRRGLTWASLPTAFPVDTTELVLTGNNLTALPPGLLDALPALRTAHLGANPWRCDCRLVPLRAWLAGRPERAPYRDLRCVAPPALRGRLLPYLAEDELRAACAPGPLCWGALAAQLALLGLGLLHALLLVLLLCRLRRLRARARARAAARLSLTDPLVAERAGTDES | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
66 | N-linked_Glycosylation | ELVLTGNNLTALPPG EEEEECCCCCCCCCC | 39.86 | 3353370 | |
83 | O-linked_Glycosylation | DALPALRTAHLGANP HHHHHHHHCCCCCCC | 21.19 | 55829007 | |
191 | Phosphorylation | ARAAARLSLTDPLVA HHHHHHHCCCCHHHH | 24.54 | 23401153 | |
193 | Phosphorylation | AAARLSLTDPLVAER HHHHHCCCCHHHHHH | 31.99 | 3353370 | |
203 | Phosphorylation | LVAERAGTDES---- HHHHHHCCCCC---- | 35.29 | 28270605 | |
206 | Phosphorylation | ERAGTDES------- HHHCCCCC------- | 48.62 | 25262027 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
191 | S | Phosphorylation | Kinase | PRKACA | P00517 | GPS |
191 | S | Phosphorylation | Kinase | PKA-FAMILY | - | GPS |
191 | S | Phosphorylation | Kinase | PKA | - | Uniprot |
191 | S | Phosphorylation | Kinase | PKA_GROUP | - | PhosphoELM |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GP1BB_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GP1BB_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
1433Z_HUMAN | YWHAZ | physical | 9454760 | |
TRAF4_HUMAN | TRAF4 | physical | 20946164 | |
TGFI1_HUMAN | TGFB1I1 | physical | 20946164 | |
NCF1_HUMAN | NCF1 | physical | 20946164 | |
FAK2_HUMAN | PTK2B | physical | 20946164 | |
LYN_HUMAN | LYN | physical | 20946164 |
loading...
N-linked Glycosylation | |
Reference | PubMed |
"Quaternary organization of GPIb-IX complex and insights into Bernard-Soulier syndrome revealed by the structures of GPIbbeta and aGPIbbeta/GPIX chimera."; McEwan P.A., Yang W., Carr K.H., Mo X., Zheng X., Li R., Emsley J.; Blood 118:5292-5301(2011). Cited for: X-RAY CRYSTALLOGRAPHY (1.24 ANGSTROMS) OF 26-146, GLYCOSYLATION ATASN-66, AND DISULFIDE BONDS. | |
"The alpha and beta chains of human platelet glycoprotein Ib are bothtransmembrane proteins containing a leucine-rich amino acidsequence."; Lopez J.A., Chung D.W., Fujikawa K., Hagen F.S., Davie E.W.,Roth G.J.; Proc. Natl. Acad. Sci. U.S.A. 85:2135-2139(1988). Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), AND GLYCOSYLATION AT ASN-66. | |
Phosphorylation | |
Reference | PubMed |
"Phosphoproteome of resting human platelets."; Zahedi R.P., Lewandrowski U., Wiesner J., Wortelkamp S., Moebius J.,Schuetz C., Walter U., Gambaryan S., Sickmann A.; J. Proteome Res. 7:526-534(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-191 AND THR-193, ANDMASS SPECTROMETRY. | |
"Platelet glycoprotein Ib beta is phosphorylated on serine 166 bycyclic AMP-dependent protein kinase."; Wardell M.R., Reynolds C.C., Berndt M.C., Wallace R.W., Fox J.E.B.; J. Biol. Chem. 264:15656-15661(1989). Cited for: PHOSPHORYLATION AT SER-191, AND PROTEIN SEQUENCE OF 186-200. |