UniProt ID | GMF1_SCHPO | |
---|---|---|
UniProt AC | O13808 | |
Protein Name | Actin-depolymerizing factor gmf1 | |
Gene Name | gmf1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 141 | |
Subcellular Localization | Cytoplasm. Nucleus. Cytoplasm, cytoskeleton, actin patch. | |
Protein Description | Actin depolymerizing factor involved in the control of the disassembly of actin patches. Binds and suppresses the arp2/3 complex functions such as the promotion of actin polymerisation and branching filaments.. | |
Protein Sequence | MSSEARMFTISDTTMKEIDRFRLRLKKSVMYAFILKVDKATKEIVPDGEIMDLQSIEEVADELSETNPRFILVSYPTKTTDGRLSTPLFMIYWRPSATPNDLSMIYASAKVWFQDVSQVHKVFEARDSEDITSEAVDEFLH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
133 | Phosphorylation | RDSEDITSEAVDEFL CCCCCCCHHHHHHHC | 24763107 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GMF1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GMF1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GMF1_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ARP2_SCHPO | arp2 | physical | 20517925 | |
ARP3_SCHPO | arp3 | physical | 20517925 | |
ARPC2_SCHPO | arc2 | physical | 20517925 | |
ISU1_SCHPO | isu1 | physical | 26771498 | |
YKU5_SCHPO | rrp9 | physical | 26771498 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...