GMF1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GMF1_SCHPO
• UniProt AC: O13808
• Protein Name: Actin-depolymerizing factor gmf1
• Gene Name: gmf1
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 141
• Subcellular Localization: Cytoplasm. Nucleus. Cytoplasm, cytoskeleton, actin patch.
• Protein Description: Actin depolymerizing factor involved in the control of the disassembly of actin patches. Binds and suppresses the arp2/3 complex functions such as the promotion of actin polymerisation and branching filaments..
• Protein Sequence: MSSEARMFTISDTTMKEIDRFRLRLKKSVMYAFILKVDKATKEIVPDGEIMDLQSIEEVADELSETNPRFILVSYPTKTTDGRLSTPLFMIYWRPSATPNDLSMIYASAKVWFQDVSQVHKVFEARDSEDITSEAVDEFLH

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
133	Phosphorylation	RDSEDITSEAVDEFL CCCCCCCHHHHHHHC		24763107

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GMF1_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GMF1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GMF1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ARP2_SCHPO	arp2	physical	20517925
ARP3_SCHPO	arp3	physical	20517925
ARPC2_SCHPO	arc2	physical	20517925
ISU1_SCHPO	isu1	physical	26771498
YKU5_SCHPO	rrp9	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.