| UniProt ID | ISU1_SCHPO | |
|---|---|---|
| UniProt AC | Q9UTC6 | |
| Protein Name | Iron sulfur cluster assembly protein 1, mitochondrial | |
| Gene Name | isu1 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 192 | |
| Subcellular Localization | Mitochondrion . Mitochondrion matrix . | |
| Protein Description | Scaffold protein for the de novo synthesis of iron-sulfur (Fe-S) clusters within mitochondria, which is required for maturation of both mitochondrial and cytoplasmic [2Fe-2S] and [4Fe-4S] proteins. First, a [2Fe-2S] cluster is transiently assembled on the scaffold protein isu1. In a second step, the cluster is released from isu1, transferred to a glutaredoxin, followed by the formation of mitochondrial [2Fe-2S] proteins, the synthesis of [4Fe-4S] clusters and their target-specific insertion into the recipient apoproteins. Cluster assembly on isu1 depends on the function of the cysteine desulfurase complex nfs1-isd11, which serves as the sulfur donor for cluster synthesis, the iron-binding protein frataxin as the putative iron donor, and the electron transfer chain comprised of ferredoxin reductase and ferredoxin, which receive their electrons from NADH.. | |
| Protein Sequence | MSVFRRSVQCVGVLPSILAQRSSLLARPANLQFLKTNSSKFVPQVTANVSRRMYHKNVLDHYNNPRNVGTLPKGDPDVGIGLVGAPACGDVMRLAIRVNKDGVIEDVKFKTFGCGSAIASSSYVTTMVKGMTLEEASKIKNTQIAKELCLPPVKLHCSMLAEDAIKSAVKHYRSKQLTPVGTTAGAIESATA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of ISU1_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ISU1_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ISU1_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ISU1_SCHPO !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| YGNB_SCHPO | nap2 | physical | 23695164 | |
| NU211_SCHPO | nup211 | physical | 23695164 | |
| ISU1_SCHPO | isu1 | physical | 11939799 | |
| YAWC_SCHPO | SPAC3F10.12c | physical | 26771498 | |
| MDV1_SCHPO | caf4 | physical | 26771498 | |
| YH7G_SCHPO | SPBC16G5.16 | physical | 26771498 | |
| YGDG_SCHPO | SPBC1773.16c | physical | 26771498 | |
| YGNB_SCHPO | nap2 | physical | 26771498 | |
| SEC6_SCHPO | sec6 | physical | 26771498 | |
| NU211_SCHPO | nup211 | physical | 26771498 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
