| UniProt ID | GLHA_HUMAN | |
|---|---|---|
| UniProt AC | P01215 | |
| Protein Name | Glycoprotein hormones alpha chain | |
| Gene Name | CGA | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 116 | |
| Subcellular Localization | Secreted. | |
| Protein Description | ||
| Protein Sequence | MDYYRKYAAIFLVTLSVFLHVLHSAPDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 63 | O-linked_Glycosylation | CFSRAYPTPLRSKKT HHHCCCCCCCCCCCE | 23.44 | 2538306 | |
| 63 | Phosphorylation | CFSRAYPTPLRSKKT HHHCCCCCCCCCCCE | 23.44 | 29214152 | |
| 68 | Acetylation | YPTPLRSKKTMLVQK CCCCCCCCCEEEEEC | 45.92 | 8307955 | |
| 69 | Acetylation | PTPLRSKKTMLVQKN CCCCCCCCEEEEECC | 40.17 | 8307955 | |
| 75 | Acetylation | KKTMLVQKNVTSEST CCEEEEECCCCCCCE | 46.00 | 8307955 | |
| 76 | N-linked_Glycosylation | KTMLVQKNVTSESTC CEEEEECCCCCCCEE | 25.80 | 7544284 | |
| 94 | Phosphorylation | KSYNRVTVMGGFKVE EECCEEEEEECEEEE | 2.84 | 2466636 | |
| 99 | Acetylation | VTVMGGFKVENHTAC EEEEECEEEECCEEE | 52.49 | 8307955 | |
| 102 | N-linked_Glycosylation | MGGFKVENHTACHCS EECEEEECCEEEEEE | 40.57 | 10821673 | |
| 107 | N-linked_Glycosylation | VENHTACHCSTCYYH EECCEEEEEEEEEEE | 13.19 | 15662415 | |
| 107 | N-linked_Glycosylation | VENHTACHCSTCYYH EECCEEEEEEEEEEE | 13.19 | 15662415 | |
| 133 | N-linked_Glycosylation | ------------------------ ------------------------ | 15662415 | ||
| 133 | N-linked_Glycosylation | ------------------------ ------------------------ | 15662415 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GLHA_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GLHA_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GLHA_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| PTN_HUMAN | PTN | physical | 16169070 | |
| FSHB_HUMAN | FSHB | physical | 11222739 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| N-linked Glycosylation | |
| Reference | PubMed |
| "Structure of human follicle-stimulating hormone in complex with itsreceptor."; Fan Q.R., Hendrickson W.A.; Nature 433:269-277(2005). Cited for: X-RAY CRYSTALLOGRAPHY (2.92 ANGSTROMS) OF 25-116 IN COMPLEX WITH FSHBAND FSHR, DISULFIDE BONDS, AND GLYCOSYLATION AT ASN-76 AND ASN-102. | |
