| UniProt ID | FSHB_HUMAN | |
|---|---|---|
| UniProt AC | P01225 | |
| Protein Name | Follitropin subunit beta | |
| Gene Name | FSHB | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 129 | |
| Subcellular Localization | Secreted. | |
| Protein Description | Stimulates development of follicle and spermatogenesis in the reproductive organs.. | |
| Protein Sequence | MKTLQFFFLFCCWKAICCNSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 25 | N-linked_Glycosylation | CNSCELTNITIAIEK CCCCCCCCEEEEEEC | 41.87 | 11502795 | |
| 25 | N-linked_Glycosylation | CNSCELTNITIAIEK CCCCCCCCEEEEEEC | 41.87 | 4835136 | |
| 42 | N-linked_Glycosylation | CRFCISINTTWCAGY ECEEEEECCCEECEE | 25.35 | 11502795 | |
| 42 | N-linked_Glycosylation | CRFCISINTTWCAGY ECEEEEECCCEECEE | 25.35 | 4835136 | |
| 76 | Phosphorylation | CTFKELVYETVRVPG EEHHHHHEEEEECCC | 20.64 | 23186163 | |
| 107 | Phosphorylation | CHCGKCDSDSTDCTV EECCCCCCCCCCCEE | 42.82 | - | |
| 120 | Phosphorylation | TVRGLGPSYCSFGEM EEECCCCCCCCCCCC | 36.65 | - | |
| 121 | Phosphorylation | VRGLGPSYCSFGEMK EECCCCCCCCCCCCC | 8.68 | - | |
| 122 | S-palmitoylation | RGLGPSYCSFGEMKE ECCCCCCCCCCCCCC | 2.97 | 29575903 | |
| 123 | Phosphorylation | GLGPSYCSFGEMKE- CCCCCCCCCCCCCC- | 28.22 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FSHB_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FSHB_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FSHB_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of FSHB_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| 229070 | Hypogonadotropic hypogonadism 24 without anosmia (HH24) | |||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| N-linked Glycosylation | |
| Reference | PubMed |
| "Structure of human follicle-stimulating hormone in complex with itsreceptor."; Fan Q.R., Hendrickson W.A.; Nature 433:269-277(2005). Cited for: X-RAY CRYSTALLOGRAPHY (2.92 ANGSTROMS) OF 19-129 IN COMPLEX WITH CGAAND FSHR, DISULFIDE BONDS, AND GLYCOSYLATION AT ASN-25 AND ASN-42. | |
| "Human follicle stimulating hormone: first proposal for the amino acidsequence of the hormone-specific, beta subunit (hFSHb)."; Shome B., Parlow A.F.; J. Clin. Endocrinol. Metab. 39:203-205(1974). Cited for: PRELIMINARY PROTEIN SEQUENCE OF 19-129. | |
