UniProt ID | GHRL_HUMAN | |
---|---|---|
UniProt AC | Q9UBU3 | |
Protein Name | Appetite-regulating hormone | |
Gene Name | GHRL | |
Organism | Homo sapiens (Human). | |
Sequence Length | 117 | |
Subcellular Localization | Secreted. | |
Protein Description | Ghrelin is the ligand for growth hormone secretagogue receptor type 1 (GHSR). Induces the release of growth hormone from the pituitary. Has an appetite-stimulating effect, induces adiposity and stimulates gastric acid secretion. Involved in growth regulation.; Obestatin may be the ligand for GPR39. May have an appetite-reducing effect resulting in decreased food intake. May reduce gastric emptying activity and jejunal motility (By similarity).. | |
Protein Sequence | MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDELEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 (in isoform 3) | Phosphorylation | - | 34.36 | - | |
3 (in isoform 4) | Phosphorylation | - | 34.36 | - | |
3 (in isoform 5) | Phosphorylation | - | 34.36 | - | |
26 | Acetylation | DLAMAGSSFLSPEHQ HHHHHCCCCCCHHHH | 29.32 | 10604470 | |
26 | Decanoylation | DLAMAGSSFLSPEHQ HHHHHCCCCCCHHHH | 29.32 | 12414809 | |
26 | Octanoylation | DLAMAGSSFLSPEHQ HHHHHCCCCCCHHHH | 29.32 | 12414809 | |
26 | Octanoylation | DLAMAGSSFLSPEHQ HHHHHCCCCCCHHHH | 29.32 | 12414809 | |
41 | Phosphorylation | RVQQRKESKKPPAKL HHHHHHHHCCCCCCC | 49.35 | 18343535 | |
91 | Phosphorylation | IKLSGVQYQQHSQAL EEECCCCHHHHHHHH | 14.03 | 29449344 | |
95 | Phosphorylation | GVQYQQHSQALGKFL CCCHHHHHHHHHHHH | 16.89 | 29449344 | |
98 | Leucine amide | YQQHSQALGKFLQDI HHHHHHHHHHHHHHH | 6.25 | - | |
98 | Amidation | YQQHSQALGKFLQDI HHHHHHHHHHHHHHH | 6.25 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
41 | S | Phosphorylation | Kinase | PRKCB | P05771-2 | GPS |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
98 | L | Amidation |
| - |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GHRL_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PI2R_HUMAN | PTGIR | physical | 18573679 | |
TA2R_HUMAN | TBXA2R | physical | 18573679 | |
PE2R3_HUMAN | PTGER3 | physical | 18573679 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...