UniProt ID | GG2_ARATH | |
---|---|---|
UniProt AC | Q93V47 | |
Protein Name | Guanine nucleotide-binding protein subunit gamma 2 | |
Gene Name | GG2 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 100 | |
Subcellular Localization | Cell membrane . Localized to the cell membrane when attached to beta subunit GB1. | |
Protein Description | Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. Involved in the abscisic acid (ABA) and ethylene signaling pathways. Regulates basipetal transport of auxin (IAA) in roots and hypocotyls, and thus modulates root architecture (e.g. lateral root formation). The heterotrimeric G-protein controls defense responses to necrotrophic and vascular fungi probably by modulating cell wall-related genes expression; involved in resistance to Plectosphaerella cucumerina.. | |
Protein Sequence | MEAGSSNSSGQLSGRVVDTRGKHRIQAELKRLEQEARFLEEELEQLEKMDNASASCKEFLDSVDSKPDPLLPETTGPVNATWDQWFEGPKEAKRCGCSIL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MEAGSSNS -------CCCCCCCC | 22223895 | ||
8 | Phosphorylation | MEAGSSNSSGQLSGR CCCCCCCCCCCCCCC | 17317660 | ||
9 | Phosphorylation | EAGSSNSSGQLSGRV CCCCCCCCCCCCCCE | 25561503 | ||
95 | S-palmitoylation | GPKEAKRCGCSIL-- CHHHHHHCCCCCC-- | 17220359 | ||
97 | Farnesylation | KEAKRCGCSIL---- HHHHHCCCCCC---- | 17220359 | ||
97 | Methylation | KEAKRCGCSIL---- HHHHHCCCCCC---- | - | ||
97 | Farnesylation | KEAKRCGCSIL---- HHHHHCCCCCC---- | 17220359 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GG2_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GG2_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GG2_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GBB_ARATH | AGB1 | physical | 11513956 | |
CERK1_ARATH | CERK1 | physical | 26414709 | |
Y5838_ARATH | BIR1 | physical | 26414709 | |
BAK1_ARATH | BAK1 | physical | 26414709 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...