GG2_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GG2_ARATH
• UniProt AC: Q93V47
• Protein Name: Guanine nucleotide-binding protein subunit gamma 2
• Gene Name: GG2
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 100
• Subcellular Localization: Cell membrane . Localized to the cell membrane when attached to beta subunit GB1.
• Protein Description: Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. Involved in the abscisic acid (ABA) and ethylene signaling pathways. Regulates basipetal transport of auxin (IAA) in roots and hypocotyls, and thus modulates root architecture (e.g. lateral root formation). The heterotrimeric G-protein controls defense responses to necrotrophic and vascular fungi probably by modulating cell wall-related genes expression; involved in resistance to Plectosphaerella cucumerina..
• Protein Sequence: MEAGSSNSSGQLSGRVVDTRGKHRIQAELKRLEQEARFLEEELEQLEKMDNASASCKEFLDSVDSKPDPLLPETTGPVNATWDQWFEGPKEAKRCGCSIL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MEAGSSNS -------CCCCCCCC		22223895
8	Phosphorylation	MEAGSSNSSGQLSGR CCCCCCCCCCCCCCC		17317660
9	Phosphorylation	EAGSSNSSGQLSGRV CCCCCCCCCCCCCCE		25561503
95	S-palmitoylation	GPKEAKRCGCSIL-- CHHHHHHCCCCCC--		17220359
97	Farnesylation	KEAKRCGCSIL---- HHHHHCCCCCC----		17220359
97	Methylation	KEAKRCGCSIL---- HHHHHCCCCCC----		-
97	Farnesylation	KEAKRCGCSIL---- HHHHHCCCCCC----		17220359

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GG2_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GG2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GG2_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GBB_ARATH	AGB1	physical	11513956
CERK1_ARATH	CERK1	physical	26414709
Y5838_ARATH	BIR1	physical	26414709
BAK1_ARATH	BAK1	physical	26414709

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.