UniProt ID | GEML1_ARATH | |
---|---|---|
UniProt AC | Q9SE96 | |
Protein Name | GEM-like protein 1 | |
Gene Name | FIP1 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 259 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MSGQENHDHGRISSTPAAASEPSKAAAHSSDYAPYPKLDPTDVTPPPPQPIPTGAAATTMPAESNPYVSPSPAPRNTMDSVKDTLGKWGKMAADATKKAEDLAGNFWQHLKTGPSVADAAVSRIAQGTKILAEGGYEKVFKQTFDCLPDEKLLKTYACYLSTSAGPVLGVMYLSTHKLAFSSDNPLSYKEGEQTLWSYYKVVLPANQLKAVNPSTSRVNTSDKYIQVISIDNHEFWFMGFVTYESAVKSLQEAVQSHGP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
13 | Phosphorylation | NHDHGRISSTPAAAS CCCCCCCCCCCCCCC | 27.14 | 19880383 | |
14 | Phosphorylation | HDHGRISSTPAAASE CCCCCCCCCCCCCCC | 35.72 | 19880383 | |
15 | Phosphorylation | DHGRISSTPAAASEP CCCCCCCCCCCCCCC | 15.34 | 19880383 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GEML1_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GEML1_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GEML1_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
JAR1_ARATH | JAR1 | physical | 17220357 | |
CPSF_ARATH | CPSF30 | physical | 16282318 | |
CTF77_ARATH | CSTF77 | physical | 16282318 | |
CFIS1_ARATH | CFIM-25 | physical | 16282318 | |
PABN1_ARATH | PABN1 | physical | 16282318 | |
PAPS4_ARATH | nPAP | physical | 16282318 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...