GEML1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GEML1_ARATH
• UniProt AC: Q9SE96
• Protein Name: GEM-like protein 1
• Gene Name: FIP1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 259
• Protein Sequence: MSGQENHDHGRISSTPAAASEPSKAAAHSSDYAPYPKLDPTDVTPPPPQPIPTGAAATTMPAESNPYVSPSPAPRNTMDSVKDTLGKWGKMAADATKKAEDLAGNFWQHLKTGPSVADAAVSRIAQGTKILAEGGYEKVFKQTFDCLPDEKLLKTYACYLSTSAGPVLGVMYLSTHKLAFSSDNPLSYKEGEQTLWSYYKVVLPANQLKAVNPSTSRVNTSDKYIQVISIDNHEFWFMGFVTYESAVKSLQEAVQSHGP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
13	Phosphorylation	NHDHGRISSTPAAAS CCCCCCCCCCCCCCC	27.14	19880383
14	Phosphorylation	HDHGRISSTPAAASE CCCCCCCCCCCCCCC	35.72	19880383
15	Phosphorylation	DHGRISSTPAAASEP CCCCCCCCCCCCCCC	15.34	19880383

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GEML1_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GEML1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GEML1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
JAR1_ARATH	JAR1	physical	17220357
CPSF_ARATH	CPSF30	physical	16282318
CTF77_ARATH	CSTF77	physical	16282318
CFIS1_ARATH	CFIM-25	physical	16282318
PABN1_ARATH	PABN1	physical	16282318
PAPS4_ARATH	nPAP	physical	16282318

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.