GEMI2_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GEMI2_DROME
• UniProt AC: Q9VVX0
• Protein Name: Protein Gemin2 {ECO:0000312|EMBL:AAF49187.1}
• Gene Name: Gem2 {ECO:0000312|EMBL:AAF49187.1, ECO:0000312|FlyBase:FBgn0036850}
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 245
• Subcellular Localization: Cytoplasm . Component of U bodies.
• Protein Description: The SMN complex plays an essential role in spliceosomal snRNP assembly in the cytoplasm, is required for pre-mRNA splicing in the nucleus and acts as a chaperone that discriminates target and non-target RNAs of Sm proteins..
• Protein Sequence: MQHEPEDQTFQLQALEICEPDSSFDPQKPPESGEEYLMHMFYERKRCPAVVTKRSSKIRNNTGNTTLEMLDNPELPPFKCLLPTPEWRDEQVKSFQAARSQVLVLRKELANNNYDQSGEPPLTSDQEKWKEFCRNQQPLLSTLLHLTQNDLELLLEMLSKWLQDPNTTVDLLHDVWLARWLYATLVCLHLPLEPHVFSTLRYIARTCIHLRNQLKEDEVQRAAPYNLLLTLTVQVFAQNDFKDYI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of GEMI2_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GEMI2_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GEMI2_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GEMI2_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SMN_DROME	Smn	physical	14605208
RAC2_DROME	Rac2	physical	14605208
ICLN_DROME	icln	physical	23333303

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.