UniProt ID | GALK1_HUMAN | |
---|---|---|
UniProt AC | P51570 | |
Protein Name | Galactokinase | |
Gene Name | GALK1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 392 | |
Subcellular Localization | ||
Protein Description | Major enzyme for galactose metabolism.. | |
Protein Sequence | MAALRQPQVAELLAEARRAFREEFGAEPELAVSAPGRVNLIGEHTDYNQGLVLPMALELMTVLVGSPRKDGLVSLLTTSEGADEPQRLQFPLPTAQRSLEPGTPRWANYVKGVIQYYPAAPLPGFSAVVVSSVPLGGGLSSSASLEVATYTFLQQLCPDSGTIAARAQVCQQAEHSFAGMPCGIMDQFISLMGQKGHALLIDCRSLETSLVPLSDPKLAVLITNSNVRHSLASSEYPVRRRQCEEVARALGKESLREVQLEELEAARDLVSKEGFRRARHVVGEIRRTAQAAAALRRGDYRAFGRLMVESHRSLRDDYEVSCPELDQLVEAALAVPGVYGSRMTGGGFGGCTVTLLEASAAPHAMRHIQEHYGGTATFYLSQAADGAKVLCL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
45 | Phosphorylation | VNLIGEHTDYNQGLV EEEECCCCCCCCCCH | 35.56 | 24043423 | |
47 | Phosphorylation | LIGEHTDYNQGLVLP EECCCCCCCCCCHHH | 15.56 | 24043423 | |
61 | Phosphorylation | PMALELMTVLVGSPR HHHHHHHHHHHCCCC | 24.26 | 28450419 | |
66 | Phosphorylation | LMTVLVGSPRKDGLV HHHHHHCCCCCCCCE | 17.66 | 28450419 | |
69 | Ubiquitination | VLVGSPRKDGLVSLL HHHCCCCCCCCEEEE | 60.58 | 21890473 | |
94 | Phosphorylation | RLQFPLPTAQRSLEP CCCCCCCCCHHCCCC | 43.00 | 20068231 | |
217 | Ubiquitination | LVPLSDPKLAVLITN EEECCCCCEEEEEEC | 54.81 | 21890473 | |
223 | Phosphorylation | PKLAVLITNSNVRHS CCEEEEEECCCHHHH | 28.56 | 21406692 | |
225 | Phosphorylation | LAVLITNSNVRHSLA EEEEEECCCHHHHHC | 28.22 | 21406692 | |
230 | Phosphorylation | TNSNVRHSLASSEYP ECCCHHHHHCCCCCC | 18.31 | 11139256 | |
233 | Phosphorylation | NVRHSLASSEYPVRR CHHHHHCCCCCCCCH | 29.06 | 28270605 | |
234 | Phosphorylation | VRHSLASSEYPVRRR HHHHHCCCCCCCCHH | 35.23 | 28270605 | |
236 | Phosphorylation | HSLASSEYPVRRRQC HHHCCCCCCCCHHHH | 14.69 | 28270605 | |
252 | Ubiquitination | EVARALGKESLREVQ HHHHHHCCHHHHHHH | 45.00 | - | |
272 | Ubiquitination | AARDLVSKEGFRRAR HHHHHHHHHHHHHHH | 55.14 | 21890473 | |
282 | Ubiquitination | FRRARHVVGEIRRTA HHHHHHHHHHHHHHH | 4.68 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GALK1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GALK1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GALK1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
A4_HUMAN | APP | physical | 21832049 | |
KCRU_HUMAN | CKMT1B | physical | 26344197 | |
GALM_HUMAN | GALM | physical | 26344197 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
230200 | Galactosemia II (GALCT2) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...