UniProt ID | FOXF2_HUMAN | |
---|---|---|
UniProt AC | Q12947 | |
Protein Name | Forkhead box protein F2 | |
Gene Name | FOXF2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 444 | |
Subcellular Localization | Nucleus. | |
Protein Description | Probable transcription activator for a number of lung-specific genes.. | |
Protein Sequence | MTTEGGPPPAPLRRACSPVPGALQAALMSPPPAAAAAAAAAPETTSSSSSSSSASCASSSSSSNSASAPSAACKSAGGGGAGAGSGGAKKASSGLRRPEKPPYSYIALIVMAIQSSPSKRLTLSEIYQFLQARFPFFRGAYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDPASEFMFEEGSFRRRPRGFRRKCQALKPMYHRVVSGLGFGASLLPQGFDFQAPPSAPLGCHSQGGYGGLDMMPAGYDAGAGAPSHAHPHHHHHHHVPHMSPNPGSTYMASCPVPAGPGGVGAAGGGGGGDYGPDSSSSPVPSSPAMASAIECHSPYTSPAAHWSSPGASPYLKQPPALTPSSNPAASAGLHSSMSSYSLEQSYLHQNAREDLSVGLPRYQHHSTPVCDRKDFVLNFNGISSFHPSASGSYYHHHHQSVCQDIKPCVM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
75 | Phosphorylation | APSAACKSAGGGGAG CCCHHCHHCCCCCCC | 31.84 | 23403867 | |
85 | Phosphorylation | GGGAGAGSGGAKKAS CCCCCCCCCCCCCCC | 33.25 | 23403867 | |
104 | Phosphorylation | RPEKPPYSYIALIVM CCCCCCCCEEEHHHH | 18.81 | - | |
153 | Phosphorylation | NSVRHNLSLNECFIK HHHHHCCCHHHEEEE | 34.17 | 20873877 | |
160 | Sumoylation | SLNECFIKLPKGLGR CHHHEEEECCCCCCC | 38.18 | - | |
160 | Acetylation | SLNECFIKLPKGLGR CHHHEEEECCCCCCC | 38.18 | 18525493 | |
160 | Sumoylation | SLNECFIKLPKGLGR CHHHEEEECCCCCCC | 38.18 | - | |
160 | Ubiquitination | SLNECFIKLPKGLGR CHHHEEEECCCCCCC | 38.18 | 29967540 | |
163 | Acetylation | ECFIKLPKGLGRPGK HEEEECCCCCCCCCC | 76.76 | 18525501 | |
188 | Phosphorylation | EFMFEEGSFRRRPRG HHCCCCCCCCCCCCH | 20.89 | 24719451 | |
204 | Acetylation | RRKCQALKPMYHRVV HHHHHHHHHHHHHHH | 30.65 | 22424773 | |
350 | Sumoylation | PGASPYLKQPPALTP CCCCCCCCCCCCCCC | 55.72 | - | |
390 | Phosphorylation | QNAREDLSVGLPRYQ HHHHHHHHCCCCCCC | 26.85 | 21815630 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FOXF2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FOXF2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FOXF2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TBP_HUMAN | TBP | physical | 9722567 | |
TF2B_HUMAN | GTF2B | physical | 9722567 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...