FKBP_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: FKBP_SCHPO
• UniProt AC: O42993
• Protein Name: Peptidyl-prolyl cis-trans isomerase
• Gene Name: fkh1
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 112
• Subcellular Localization: Cytoplasm . Nucleus .
• Protein Description: PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Has an important role in sexual development and serves as the target for rapamycin action..
• Protein Sequence: MGVEKQVISSGNGQDFPKPGDRITMHYTGTLTNGKKFDSSVDRGSPFVCTIGVGQLIRGWDEGVPKMSLGEKAKLTITPDYGYGPRGFPGLIPPNSTLLFDVELLAINDKKA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
39	Phosphorylation	TNGKKFDSSVDRGSP CCCCEECCCCCCCCC	35.08	29996109
40	Phosphorylation	NGKKFDSSVDRGSPF CCCEECCCCCCCCCE	29.86	25720772
45	Phosphorylation	DSSVDRGSPFVCTIG CCCCCCCCCEEEEEC	18.96	29996109

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of FKBP_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of FKBP_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of FKBP_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TOR2_SCHPO	tor2	genetic	22645648
CUT1_SCHPO	cut1	genetic	22645648
SECU_SCHPO	cut2	genetic	22645648
ELP3_SCHPO	elp3	genetic	22681890
FFT3_SCHPO	fft3	genetic	22681890

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.