| UniProt ID | FKB11_HUMAN | |
|---|---|---|
| UniProt AC | Q9NYL4 | |
| Protein Name | Peptidyl-prolyl cis-trans isomerase FKBP11 | |
| Gene Name | FKBP11 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 201 | |
| Subcellular Localization |
Membrane Single-pass membrane protein . |
|
| Protein Description | PPIases accelerate the folding of proteins during protein synthesis.. | |
| Protein Sequence | MTLRPSLLPLHLLLLLLLSAAVCRAEAGLETESPVRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVDGRIIDTSLTRDPLVIELGQKQVIPGLEQSLLDMCVGEKRRAIIPSHLAYGKRGFPPSVPADAVVQYDVELIALIRANYWLKLVKGILPLVGMAMVPALLGLIGYHLYRKANRPKVSKKKLKEEKRNKSKKK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 76 | Phosphorylation | VDGRIIDTSLTRDPL ECCEEEECCCCCCCE | 18.41 | 21406692 | |
| 76 | O-linked_Glycosylation | VDGRIIDTSLTRDPL ECCEEEECCCCCCCE | 18.41 | 55835969 | |
| 77 | Phosphorylation | DGRIIDTSLTRDPLV CCEEEECCCCCCCEE | 24.80 | 21406692 | |
| 79 | O-linked_Glycosylation | RIIDTSLTRDPLVIE EEEECCCCCCCEEEE | 32.56 | OGP | |
| 90 | Ubiquitination | LVIELGQKQVIPGLE EEEEECCCCCCCCHH | 44.74 | - | |
| 108 | Ubiquitination | LDMCVGEKRRAIIPS HHHHHCCCCCHHCHH | 41.05 | - | |
| 115 | Phosphorylation | KRRAIIPSHLAYGKR CCCHHCHHHHHCCCC | 22.26 | - | |
| 119 | Phosphorylation | IIPSHLAYGKRGFPP HCHHHHHCCCCCCCC | 29.55 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FKB11_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FKB11_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FKB11_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TF65_HUMAN | RELA | physical | 21988832 | |
| GOPC_HUMAN | GOPC | physical | 28514442 | |
| AN13D_HUMAN | ANKRD13D | physical | 28514442 | |
| AHNK2_HUMAN | AHNAK2 | physical | 28514442 | |
| PHAG1_HUMAN | PAG1 | physical | 28514442 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
