FIE_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: FIE_ARATH
• UniProt AC: Q9LT47
• Protein Name: Polycomb group protein FERTILIZATION-INDEPENDENT ENDOSPERM
• Gene Name: FIE
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 369
• Subcellular Localization: Nucleus . Excluded from the nucleolus.
• Protein Description: Polycomb group (PcG) protein. PcG proteins act by forming multiprotein complexes, which are required to maintain the transcriptionally repressive state of homeotic genes throughout development. PcG proteins are not required to initiate repression, but to maintain it during later stages of development. They probably act via the methylation of histones, rendering chromatin heritably changed in its expressibility. Required to prevent the proliferation of the central cell by repressing unknown target genes before fertilization. Probably also involved in floral repression mechanism established during early plant development. Regulates the anteroposterior organization of the endosperm. Interacts with the promoter and represses the transcription of genes such as PHE1, that are paternally active and maternally silenced..
• Protein Sequence: MSKITLGNESIVGSLTPSNKKSYKVTNRIQEGKKPLYAVVFNFLDARFFDVFVTAGGNRITLYNCLGDGAISALQSYADEDKEESFYTVSWACGVNGNPYVAAGGVKGIIRVIDVNSETIHKSLVGHGDSVNEIRTQPLKPQLVITASKDESVRLWNVETGICILIFAGAGGHRYEVLSVDFHPSDIYRFASCGMDTTIKIWSMKEFWTYVEKSFTWTDDPSKFPTKFVQFPVFTASIHTNYVDCNRWFGDFILSKSVDNEILLWEPQLKENSPGEGASDVLLRYPVPMCDIWFIKFSCDLHLSSVAIGNQEGKVYVWDLKSCPPVLITKLSHNQSKSVIRQTAMSVDGSTILACCEDGTIWRWDVITK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSKITLGNE ------CCCEECCCC	32.53	19880383
14	Phosphorylation	GNESIVGSLTPSNKK CCCCEECCCCCCCCC	20.41	19880383
16	Phosphorylation	ESIVGSLTPSNKKSY CCEECCCCCCCCCCE	26.77	24243849
18	Phosphorylation	IVGSLTPSNKKSYKV EECCCCCCCCCCEEE	56.92	24243849
273	Phosphorylation	EPQLKENSPGEGASD CCCCCCCCCCCCCCH	35.06	30291188
279	Phosphorylation	NSPGEGASDVLLRYP CCCCCCCCHHHHHCC	38.82	23776212

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of FIE_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of FIE_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of FIE_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MEDEA_ARATH	MEA	physical	11114524
MEDEA_ARATH	MEA	physical	11148284
MSI1_ARATH	MSI1	physical	12970192
CLF_ARATH	CLF	physical	14871310
MEDEA_ARATH	MEA	physical	14871310
RBR1_ARATH	RBR1	physical	15221456
RB_HUMAN	RB1	physical	15221456
MEDEA_ARATH	MEA	physical	15469499
VRN2_ARATH	VRN2	physical	16983073
MEDEA_ARATH	MEA	physical	23146178
DNMT1_ARATH	MET1	physical	23146178

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.