UniProt ID | FBX27_HUMAN | |
---|---|---|
UniProt AC | Q8NI29 | |
Protein Name | F-box only protein 27 | |
Gene Name | FBXO27 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 283 | |
Subcellular Localization | ||
Protein Description | Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex. Able to recognize and bind denatured glycoproteins, which are modified with complex-type oligosaccharides.. | |
Protein Sequence | MGASVSRGRAARVPAPEPEPEEALDLSQLPPELLLVVLSHVPPRTLLGRCRQVCRGWRALVDGQALWLLILARDHGATGRALLHLARSCQSPARNARPCPLGRFCARRPIGRNLIRNPCGQEGLRKWMVQHGGDGWVVEENRTTVPGAPSQTCFVTSFSWCCKKQVLDLEEEGLWPELLDSGRIEICVSDWWGARHDSGCMYRLLVQLLDANQTVLDKFSAVPDPIPQWNNNACLHVTHVFSNIKMGVRFVSFEHRGQDTQFWAGHYGARVTNSSVIVRVRLS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | Phosphorylation | ----MGASVSRGRAA ----CCCCCCCCCCC | 18.20 | 24043423 | |
6 | Phosphorylation | --MGASVSRGRAARV --CCCCCCCCCCCCC | 26.90 | 24043423 | |
260 | Phosphorylation | FEHRGQDTQFWAGHY EEECCCCCEEEEEEC | 20.13 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FBX27_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FBX27_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FBX27_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CHIP_HUMAN | STUB1 | physical | 16682404 | |
CUL1_HUMAN | CUL1 | physical | 18203720 | |
SKP1_HUMAN | SKP1 | physical | 18203720 | |
RBX1_HUMAN | RBX1 | physical | 18203720 | |
CUL1_HUMAN | CUL1 | physical | 21640084 | |
RBX1_HUMAN | RBX1 | physical | 21640084 | |
SKP1_HUMAN | SKP1 | physical | 21640084 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...