UniProt ID | FA32A_HUMAN | |
---|---|---|
UniProt AC | Q9Y421 | |
Protein Name | Protein FAM32A | |
Gene Name | FAM32A | |
Organism | Homo sapiens (Human). | |
Sequence Length | 112 | |
Subcellular Localization |
Isoform 1: Nucleus. Isoform 2: Nucleus. |
|
Protein Description | Isoform 1, but not isoform 2 or isoform 3, may induce G2 arrest and apoptosis. May also increase cell sensitivity to apoptotic stimuli.. | |
Protein Sequence | MEAYEQVQKGPLKLKGVAELGVTKRKKKKKDKDKAKLLEAMGTSKKNEEEKRRGLDKRTPAQAAFEKMQEKRQMERILKKASKTHKQRVEDFNRHLDTLTEHYDIPKVSWTK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MEAYEQVQ -------CHHHHHHH | 6.32 | - | |
4 | Phosphorylation | ----MEAYEQVQKGP ----CHHHHHHHCCC | 8.12 | 25159151 | |
24 | Acetylation | VAELGVTKRKKKKKD HHHHCCCCCCCCCCC | 60.87 | 25953088 | |
43 | Phosphorylation | KLLEAMGTSKKNEEE HHHHHHCCCCCCHHH | 25.04 | - | |
44 | Phosphorylation | LLEAMGTSKKNEEEK HHHHHCCCCCCHHHH | 35.58 | - | |
59 | Phosphorylation | RRGLDKRTPAQAAFE HHCCCCCCHHHHHHH | 28.81 | 28555341 | |
98 | Phosphorylation | DFNRHLDTLTEHYDI HHHHHHHHHHHHCCC | 41.77 | 29978859 | |
100 | Phosphorylation | NRHLDTLTEHYDIPK HHHHHHHHHHCCCCC | 23.86 | 27642862 | |
103 | Phosphorylation | LDTLTEHYDIPKVSW HHHHHHHCCCCCCCC | 14.88 | 25884760 | |
107 | Ubiquitination | TEHYDIPKVSWTK-- HHHCCCCCCCCCC-- | 49.59 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FA32A_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FA32A_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FA32A_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
A4_HUMAN | APP | physical | 21832049 | |
CWC22_HUMAN | CWC22 | physical | 22365833 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, AND MASS SPECTROMETRY. |