ERR3_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ERR3_MOUSE
• UniProt AC: P62509
• Protein Name: Estrogen-related receptor gamma
• Gene Name: Esrrg
• Organism: Mus musculus (Mouse).
• Sequence Length: 458
• Subcellular Localization: Nucleus .
• Protein Description: Orphan receptor that acts as transcription activator in the absence of bound ligand. Binds specifically to an estrogen response element and activates reporter genes controlled by estrogen response elements. Induces the expression of PERM1 in the skeletal muscle..
• Protein Sequence: MDSVELCLPESFSLHYEEELLCRMSNKDRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYMLNSMPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRIDAENSPYLNPQLVQPAKKPYNKIVSHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPLLRQTSTKAVQHFYNIKLEGKVPMHKLFLEMLEAKV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
45	Phosphorylation	FIKTEPSSPASLTDS CCCCCCCCCCCCCCC	34.89	22817900
179	Phosphorylation	ITKRRRKSCQACRFM EHHHHHHHHHHHHHH	15.06	-
195	Ubiquitination	CLKVGMLKEGVRLDR HHHHCCCCCCCCHHH	43.46	-
219	Phosphorylation	RRIDAENSPYLNPQL HHCCCCCCCCCCHHH	13.36	21082442
221	Phosphorylation	IDAENSPYLNPQLVQ CCCCCCCCCCHHHCC	20.94	21183079
317	O-linked_Glycosylation	ILGVVYRSLSFEDEL HHHHHHHHCCCCCCE	15.63	27335230
319	O-linked_Glycosylation	GVVYRSLSFEDELVY HHHHHHCCCCCCEEE	28.03	27335230
356	Phosphorylation	ILQLVKKYKSMKLEK HHHHHHHHHCCCCCH	11.54	20139300
358	Phosphorylation	QLVKKYKSMKLEKEE HHHHHHHCCCCCHHH	20.33	20139300
360	Sumoylation	VKKYKSMKLEKEEFV HHHHHCCCCCHHHHH	61.66	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
179	S	Phosphorylation	Kinase	AKT1	P31749	PSP
179	S	Phosphorylation	Kinase	AKT1	P31750	PSP

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
40	K	Phosphorylation	Phosphorylation on Ser-45 enhances sumoylation on Lys-40 thus repressing transcriptional activity.	-
40	K	Phosphorylation	Sumoylation on Lys-40 is enhanced by phosphorylation at Ser-45 and represses transcriptional activity.	-
40	K	Sumoylation	Phosphorylation on Ser-45 enhances sumoylation on Lys-40 thus repressing transcriptional activity.	-
40	K	Sumoylation	Sumoylation on Lys-40 is enhanced by phosphorylation at Ser-45 and represses transcriptional activity.	-
45	S	Phosphorylation	Phosphorylation on Ser-45 enhances sumoylation on Lys-40 thus repressing transcriptional activity.	-
45	S	Phosphorylation	Sumoylation on Lys-40 is enhanced by phosphorylation at Ser-45 and represses transcriptional activity.	-
45	S	Sumoylation	Phosphorylation on Ser-45 enhances sumoylation on Lys-40 thus repressing transcriptional activity.	-
45	S	Sumoylation	Sumoylation on Lys-40 is enhanced by phosphorylation at Ser-45 and represses transcriptional activity.	-

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ERR3_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PRGC2_HUMAN	PPARGC1B	genetic	12470660
PRGC1_HUMAN	PPARGC1A	genetic	12470660
PRGC2_HUMAN	PPARGC1B	physical	12470660
PRGC1_HUMAN	PPARGC1A	physical	12470660
HLF_MOUSE	Hlf	physical	20211142

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.