| UniProt ID | ERD15_ARATH | |
|---|---|---|
| UniProt AC | Q39096 | |
| Protein Name | Protein EARLY RESPONSIVE TO DEHYDRATION 15 | |
| Gene Name | ERD15 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 163 | |
| Subcellular Localization | Cytoplasm . | |
| Protein Description | Central component of stress responses that interacts with poly(A)-binding proteins. Negative regulator of abscisic acid (ABA) responses, including resistance to drought and freezing as well as stomatal closure regulation. Mediates resistance to the bacterial necrotroph pathogen Erwinia carotovora subsp. carotovora and promotes the induction of marker genes for systemic acquired resistance (SAR).. | |
| Protein Sequence | MAMVSGRRSTLNPDAPLFIPAAVRQVEDFSPEWWQLVTTSTWYPDYWISQQQQGADGFYDNGENENGGGHIDVADLLPESFDFDDMEDFFDTDAAEFDQGFDGRMYYQAPSEFGFGKNGEMVKKSSGNRSPRSIVEPAKYAEKPAKWGNQRVAAAPRNIHQPR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 106 | Phosphorylation | QGFDGRMYYQAPSEF CCCCCCEEEECCCCC | 23172892 | ||
| 107 | Phosphorylation | GFDGRMYYQAPSEFG CCCCCEEEECCCCCC | 23172892 | ||
| 111 | Phosphorylation | RMYYQAPSEFGFGKN CEEEECCCCCCCCCC | 27545962 | ||
| 130 | Phosphorylation | KKSSGNRSPRSIVEP ECCCCCCCCCHHCCH | 27531888 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ERD15_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ERD15_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ERD15_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| PABP2_ARATH | PAB2 | physical | 15650869 | |
| PABP5_ARATH | PAB5 | physical | 15650869 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
