UniProt ID | EPO_HUMAN | |
---|---|---|
UniProt AC | P01588 | |
Protein Name | Erythropoietin | |
Gene Name | EPO | |
Organism | Homo sapiens (Human). | |
Sequence Length | 193 | |
Subcellular Localization | Secreted. | |
Protein Description | Hormone involved in the regulation of erythrocyte proliferation and differentiation and the maintenance of a physiological level of circulating erythrocyte mass. Binds to EPOR leading to EPOR dimerization and JAK2 activation thereby activating specific downstream effectors, including STAT1 and STAT3.. | |
Protein Sequence | MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
51 | N-linked_Glycosylation | LEAKEAENITTGCAE HHHHHHHCCCCHHHH | 43.91 | 3949763 | |
51 | N-linked_Glycosylation | LEAKEAENITTGCAE HHHHHHHCCCCHHHH | 43.91 | 3949763 | |
54 | Sulfoxidation | KEAENITTGCAEHCS HHHHCCCCHHHHHCC | 26.85 | 18661870 | |
65 | N-linked_Glycosylation | EHCSLNENITVPDTK HHCCCCCCCCCCCCC | 33.87 | 3949763 | |
65 | N-linked_Glycosylation | EHCSLNENITVPDTK HHCCCCCCCCCCCCC | 33.87 | 3949763 | |
110 | N-linked_Glycosylation | RGQALLVNSSQPWEP HCCEEECCCCCCCCC | 35.59 | 3949763 | |
110 | N-linked_Glycosylation | RGQALLVNSSQPWEP HCCEEECCCCCCCCC | 35.59 | 3949763 | |
111 | Phosphorylation | GQALLVNSSQPWEPL CCEEECCCCCCCCCE | 23.91 | 18452278 | |
127 | Phosphorylation | LHVDKAVSGLRSLTT HHHHHHHHHHHHHHH | 36.65 | 18452278 | |
131 | Phosphorylation | KAVSGLRSLTTLLRA HHHHHHHHHHHHHHH | 34.80 | - | |
133 | Phosphorylation | VSGLRSLTTLLRALG HHHHHHHHHHHHHHC | 19.35 | 21964256 | |
134 | Phosphorylation | SGLRSLTTLLRALGA HHHHHHHHHHHHHCC | 29.14 | 21964256 | |
153 | O-linked_Glycosylation | ISPPDAASAAPLRTI CCCCCHHHCCCCCEE | 27.04 | 3949763 | |
153 | O-linked_Glycosylation | ISPPDAASAAPLRTI CCCCCHHHCCCCCEE | 27.04 | 3949763 | |
161 | Phosphorylation | AAPLRTITADTFRKL CCCCCEECHHHHHHH | 20.19 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of EPO_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of EPO_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of EPO_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
EPOR_HUMAN | EPOR | physical | 10318834 | |
EPOR_HUMAN | EPOR | physical | 9808045 | |
EPOR_HUMAN | EPOR | physical | 17327410 | |
EPOR_HUMAN | EPOR | physical | 15358619 | |
EPOR_HUMAN | EPOR | physical | 28514442 | |
GINM1_HUMAN | GINM1 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
612623 | Microvascular complications of diabetes 2 (MVCD2) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
N-linked Glycosylation | |
Reference | PubMed |
"Structural characterization of human erythropoietin."; Lai P.H., Everett R., Wang F.F., Arakawa T., Goldwasser E.; J. Biol. Chem. 261:3116-3121(1986). Cited for: PROTEIN SEQUENCE OF 28-193, AND DISULFIDE BONDS. | |
O-linked Glycosylation | |
Reference | PubMed |
"Structural characterization of human erythropoietin."; Lai P.H., Everett R., Wang F.F., Arakawa T., Goldwasser E.; J. Biol. Chem. 261:3116-3121(1986). Cited for: PROTEIN SEQUENCE OF 28-193, AND DISULFIDE BONDS. |